- Suchergebnis für P24462
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P24462" wurden 18 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ELK-ELK7465.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human CYP3A7. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human CYP3A7....
| Schlagworte: | CYPIIIA7, P450HLp2, Cytochrome P450 3A7, Cytochrome P450-HFLA |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
Artikelnummer: CSB-EP006444HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-503aa. Protein Length: Full Length. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: MDLIPNLAVE TWLLLAVSLI LLYLYGTRTH GLFKKLGIPG PTPLPFLGNA LSFRKGYWTF DMECYKKYRK VWGIYDCQQP MLAITDPDMI KTVLVKECYS VFTNRRPFGP VGFMKNAISI AEDEEWKRIR...
| Schlagworte: | CYPIIIA7, P450HLp2, Cytochrome P450 3A7, Cytochrome P450-HFLA, Recombinant Human Cytochrome P450 3A7 (CYP3A7) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 64.4 kD |
ab 292,00 €
Artikelnummer: CSB-PA007546.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-P450HLp2, Anti-CYPIIIA7, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA, Aryl hydrocarbon hydroxylase antibody,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 126,00 €
Artikelnummer: CSB-PA929315.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-P450HLp2, Anti-CYPIIIA7, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA, Cytochrome P450, family 3, subfamily A,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
284,00 €
NEU
Artikelnummer: TGM-TMPH-03881-100ug
Description: CYP3A7 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P24462.
| Schlagworte: | Cytochrome P450-HFLA , CYPIIIA7 , Cytochrome P450 3A7 , P450HLp2 , CYP3A7 |
| MW: | 64.4 kD |
ab 93,00 €
Artikelnummer: ABS-PP-4400-L.100
Protein function: A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the...
| Schlagworte: | Cytochrome P450 3A7, CYPIIIA7, Cytochrome P450-HFLA, P450HLp2, Recombinant Human CYP3A7 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26 kD |
ab 115,00 €
Artikelnummer: C8929-04C.50
CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is...
| Schlagworte: | EC=1.14.14.1 |
| Anwendung: | WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
850,00 €
Artikelnummer: 154299.10
Recombinant protein corresponding to Pro344-Asp497 with an N-Terminal His-Tag from human CYP3A7expressed in E. coli (P24462). Amino Acid Sequence: PPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRD, Predicted...
ab 445,00 €
Artikelnummer: 471974.96
Sample Type:, Cell line of choice, Intended Use: The Cytochrome P450 3A7 Colorimetric Cell-Based ELISA allows for qualitative detection of CytochromeP4503A7 in plated and fixed cells. Sensitivity: >5000cells/well, Assay Time: 4.5 hours, Reactivity: Human, Detection Method: Colorimetric 450 nm, Format: Cell-Based...
| Schlagworte: | P450HLp2, CYPIIIA7, Cytochrome P450 3A7, Cytochrome P450-HFLA |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
920,00 €
Artikelnummer: ATA-APrEST95317.100
Protein function: A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the...
| Schlagworte: | P450HLp2, CYPIIIA7, Cytochrome P450 3A7, Cytochrome P450-HFLA |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ATA-HPA075539.100
Protein function: A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis (PubMed:9555064, PubMed:11093772, PubMed:14559847, PubMed:12865317, PubMed:17178770). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the...
| Schlagworte: | Anti-P450HLp2, Anti-CYPIIIA7, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ELK-ES4928.100
This gene encodes a member of the cytochrome P450 superfamily of enzymes, which participate in drug metabolism and the synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. This...
| Schlagworte: | Anti-CYPIIIA7, Anti-P450HLp2, Anti-Cytochrome P450 3A7, Anti-Cytochrome P450-HFLA, CYP3A7 rabbit pAb |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €