- Suchergebnis für P12980
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P12980" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA075004.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 82% and to rat: 82%
| Schlagworte: | Anti-LYL1, Anti-BHLHA18, Anti-bHLHa18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Anwendung: | ICC, ChIP |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: CSB-PA284084.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-LYL1, Anti-bHLHa18, Anti-BHLHA18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
284,00 €
Artikelnummer: ATA-HPA072177.100
Polyclonal Antibody against Human LYL1, Gene description: LYL1 basic helix-loop-helix family member, Alternative Gene Names: bHLHa18, Validated applications: ICC, Uniprot ID: P12980, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 91% Rat gene identity: 91%
| Schlagworte: | Anti-LYL1, Anti-BHLHA18, Anti-bHLHa18, Anti-Protein lyl-1, Anti-Lymphoblastic leukemia-derived sequence 1, Anti-Class A... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: VHPS-5435
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | LYL1, bHLHa18, BHLHA18, Protein lyl-1, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1 |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ATA-APrEST93260.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | LYL1, BHLHA18, bHLHa18, Protein lyl-1, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABD-8C10354.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-Lyl-1 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-LYL1, Anti-bHLHa18, Anti-BHLHA18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
628,00 €
Artikelnummer: ELK-ES6144.100
This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia. [provided by...
| Schlagworte: | Anti-LYL1, Anti-BHLHA18, Anti-bHLHa18, Anti-Protein lyl-1, Anti-Lymphoblastic leukemia-derived sequence 1, Anti-Class A... |
| Anwendung: | IHC, IF, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
Artikelnummer: CSB-PA009891.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-LYL1, Anti-bHLHa18, Anti-BHLHA18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
126,00 €
Artikelnummer: ATA-APrEST95852.100
PrEST Antigen LYL1, Gene description: LYL1 basic helix-loop-helix family member, Alternative Gene Names: bHLHa18, Antigen sequence: TAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 91% Rat gene identity: 91%
| Schlagworte: | LYL1, bHLHa18, BHLHA18, Protein lyl-1, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €