Zu "P0A7Q1" wurden 1 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S...
Artikelnummer: 375128.100
Source:, Recombinant protein corresponding to aa7-64 from E. coli 50S Ribosomal Protein L35, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.5kD, AA Sequence: VRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLRPKAMVSKGDLGLVIACLPY, Storage and Stability: May be stored at 4°C for short-term only....
| Schlagworte: | rpmI, b1717, Ribosomal protein A, 50S ribosomal protein L35, Large ribosomal subunit protein bL35 |
| MW: | 33,5 |
ab 636,00 €
