- Suchergebnis für P09912
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P09912" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-HUFI01005.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
698,00 €
Artikelnummer: CSB-EP011016HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 24-130aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: GKKKCSESSD SGSGFWKALT FMAVGGGLAV AGLPALGFTG AGIAANSVAA SLMSWSAILN GGGVPAGGLV ATLQSLGAGG SSVVIGNIGA LMGYATHKYL DSEEDEE. Purity:...
| Schlagworte: | Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6, Recombinant Human Interferon... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 24.4 kD |
ab 219,00 €
Artikelnummer: CSB-YP011016HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 24-130aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GKKKCSESSD SGSGFWKALT FMAVGGGLAV AGLPALGFTG AGIAANSVAA SLMSWSAILN GGGVPAGGLV ATLQSLGAGG SSVVIGNIGA LMGYATHKYL DSEEDEE. Purity: Greater...
| Schlagworte: | Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6, Recombinant Human Interferon... |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | human |
| MW: | 12.4 kD |
ab 242,00 €
Artikelnummer: CSB-PA253751.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6, Ifi-6-16 antibody, IFI6... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
284,00 €
Artikelnummer: TGM-TMPH-01548-100ug
Description: Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been shown to have a pro-apoptotic activity. Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation...
| Schlagworte: | Interferon-induced protein 6-16, Interferon alpha-inducible protein 6, IFI6 |
| MW: | 24.4 kD |
ab 187,00 €
Artikelnummer: TGM-TMPH-01548-10ug
Description: Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been shown to have a pro-apoptotic activity. Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation...
| Schlagworte: | Interferon alpha-inducible protein 6 , G1P3 , Interferon-induced protein 6-16 (Ifi-6-16) , IFI6 |
| MW: | 24.4 kD |
ab 71,00 €
Artikelnummer: 036879.200
This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of...
| Schlagworte: | Anti-G1P3, Anti-IFI6, Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: 373737.1
Source:, Recombinant protein corresponding to aa24-130 from human IFI6, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.4kD, AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE, Storage and Stability: May be stored...
| Schlagworte: | Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6 |
| MW: | 24,4 |
ab 603,00 €
Artikelnummer: 373738.100
Source:, Recombinant protein corresponding to aa24-130 from human IFI6, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.3kD, AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE, Storage and Stability: May be stored at 4°C...
| Schlagworte: | Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6 |
| MW: | 12,3 |
ab 557,00 €
Artikelnummer: ELK-ES10713.100
This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of...
| Schlagworte: | Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6, IFI6 rabbit pAb |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Artikelnummer: CSB-CL011016HU.10
Length: 393 Sequence: atgcggcaga aggcggtatc gcttttcttg tgctacctgc tgctcttcac ttgcagtggg gtggaggcag gtaagaaaaa gtgctcggag agctcggaca gcggctccgg gttctggaag gccctgacct tcatggccgt cggaggagga ctcgcagtcg ccgggctgcc cgcgctgggc ttcaccggcg ccggcatcgc ggccaactcg gtggctgcct cgctgatgag ctggtctgcg atcctgaatg ggggcggcgt...
| Schlagworte: | Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
160,00 €
Artikelnummer: CSB-PA011016ZA01HU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6, IFI6 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Homo sapiens (Human) |
ab 1.529,00 €