Zu "P09912" wurden 12 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Human Interferon alpha-inducible protein 6 / IFI6 ELISA Kit
Human Interferon alpha-inducible protein 6 / IFI6 ELISA Kit

Artikelnummer: G-HUFI01005.96

Anwendung: ELISA
Spezies-Reaktivität: human
698,00 €
Bewerten
Interferon alpha-inducible protein 6 (IFI6), human, recombinant
Interferon alpha-inducible protein 6 (IFI6), human,...

Artikelnummer: CSB-EP011016HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 24-130aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: GKKKCSESSD SGSGFWKALT FMAVGGGLAV AGLPALGFTG AGIAANSVAA SLMSWSAILN GGGVPAGGLV ATLQSLGAGG SSVVIGNIGA LMGYATHKYL DSEEDEE. Purity:...
Schlagworte: Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6, Recombinant Human Interferon...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 24.4 kD
ab 219,00 €
Bewerten
Interferon alpha-inducible protein 6 (IFI6), human, recombinant
Interferon alpha-inducible protein 6 (IFI6), human,...

Artikelnummer: CSB-YP011016HU.1

Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 24-130aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GKKKCSESSD SGSGFWKALT FMAVGGGLAV AGLPALGFTG AGIAANSVAA SLMSWSAILN GGGVPAGGLV ATLQSLGAGG SSVVIGNIGA LMGYATHKYL DSEEDEE. Purity: Greater...
Schlagworte: Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6, Recombinant Human Interferon...
Anwendung: Activity not tested
Exprimiert in: Yeast
Ursprungsart: human
MW: 12.4 kD
ab 242,00 €
Bewerten
Anti-IFI6
Anti-IFI6

Artikelnummer: CSB-PA253751.100

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Schlagworte: Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6, Ifi-6-16 antibody, IFI6...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
284,00 €
Bewerten
IFI6 Protein, Human, Recombinant (B2M & His)
IFI6 Protein, Human, Recombinant (B2M & His)

Artikelnummer: TGM-TMPH-01548-100ug

Description: Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been shown to have a pro-apoptotic activity. Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation...
Schlagworte: Interferon-induced protein 6-16, Interferon alpha-inducible protein 6, IFI6
MW: 24.4 kD
ab 187,00 €
Bewerten
IFI6 Protein, Human, Recombinant (B2M & His)
IFI6 Protein, Human, Recombinant (B2M & His)

Artikelnummer: TGM-TMPH-01548-10ug

Description: Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been shown to have a pro-apoptotic activity. Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation...
Schlagworte: Interferon alpha-inducible protein 6 , G1P3 , Interferon-induced protein 6-16 (Ifi-6-16) , IFI6
MW: 24.4 kD
ab 71,00 €
Bewerten
Anti-IFI6, NT (IFI6, G1P3, Interferon alpha-inducible protein 6, Interferon-induced protein 6-16)
Anti-IFI6, NT (IFI6, G1P3, Interferon alpha-inducible...

Artikelnummer: 036879.200

This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of...
Schlagworte: Anti-G1P3, Anti-IFI6, Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
IFI6, Recombinant, Human, aa24-130, His-B2M-Tag (Interferon alpha-inducible Protein 6)
IFI6, Recombinant, Human, aa24-130, His-B2M-Tag...

Artikelnummer: 373737.1

Source:, Recombinant protein corresponding to aa24-130 from human IFI6, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.4kD, AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE, Storage and Stability: May be stored...
Schlagworte: Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6
MW: 24,4
ab 603,00 €
Bewerten
IFI6, Recombinant, Human, aa24-130, His-Tag (Interferon alpha-inducible Protein 6)
IFI6, Recombinant, Human, aa24-130, His-Tag (Interferon...

Artikelnummer: 373738.100

Source:, Recombinant protein corresponding to aa24-130 from human IFI6, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.3kD, AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE, Storage and Stability: May be stored at 4°C...
Schlagworte: Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6
MW: 12,3
ab 557,00 €
Bewerten
Anti-IFI6
Anti-IFI6

Artikelnummer: ELK-ES10713.100

This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of...
Schlagworte: Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6, IFI6 rabbit pAb
Anwendung: WB, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, rat, mouse,
ab 173,00 €
Bewerten
IFI6 (Vector pUC, Accession No. BC011601)
IFI6 (Vector pUC, Accession No. BC011601)

Artikelnummer: CSB-CL011016HU.10

Length: 393 Sequence: atgcggcaga aggcggtatc gcttttcttg tgctacctgc tgctcttcac ttgcagtggg gtggaggcag gtaagaaaaa gtgctcggag agctcggaca gcggctccgg gttctggaag gccctgacct tcatggccgt cggaggagga ctcgcagtcg ccgggctgcc cgcgctgggc ttcaccggcg ccggcatcgc ggccaactcg gtggctgcct cgctgatgag ctggtctgcg atcctgaatg ggggcggcgt...
Schlagworte: Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
160,00 €
Bewerten
Anti-IFI6
Anti-IFI6

Artikelnummer: CSB-PA011016ZA01HU.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6, IFI6 Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Homo sapiens (Human)
ab 1.529,00 €
Bewerten