- Suchergebnis für P07150
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P07150" wurden 6 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-AEKE04901.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat ANXA1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat ANXA1. Next,...
| Schlagworte: | p35, Anxa1, Annexin I, Annexin-1, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase A2... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
694,00 €
Artikelnummer: ELK-ELK10814.48
Plays important roles in the innate immune response as effector of glucocorticoid-mediated responses and regulator of the inflammatory process. Has anti-inflammatory activity. Plays a role in glucocorticoid-mediated down-regulation of the early phase of the inflammatory response. Contributes to the adaptive immune...
| Schlagworte: | p35, Anxa1, Annexin-1, Annexin I, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase A2... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 374,00 €
Artikelnummer: VRPS-324
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | p35, Anx1, Anxa1, Annexin-1, Annexin I, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase... |
| Anwendung: | RNA quantification |
54,00 €
Artikelnummer: 153520.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P07150, Fragment: Met1~Asn346 (Accession No: P07150), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-MAMVSEFLKQ ACYIEKQEQE YVQAVKSYKG GPGSAVSPYP SFNPSSDVAA LHKAIMVKGV DEATIIDILT...
ab 459,00 €
Artikelnummer: G-AEFI00955.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Plays important roles in the innate immune response as effector of glucocorticoid-mediated...
| Schlagworte: | Anx1, Anxa1 |
| Anwendung: | Sandwich ELISA, Double Antibody |
| Spezies-Reaktivität: | rat |
698,00 €
Artikelnummer: CSB-PA001836XA01RA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-p35, Anti-Anx1, Anti-Anxa1, Anti-Annexin-1, Anti-Annexin I, Anti-Annexin A1, Anti-Calpactin-2, Anti-Lipocortin I,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Rattus norvegicus (Rat) |
ab 1.529,00 €