Zu "P06728" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Mouse APOA4 (Apolipoprotein A4) ELISA Kit
Artikelnummer: ELK-ELK3459.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse APOA4. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse APOA4. Next,...
| Schlagworte: | Apoa4, ApoA-IV, Apo-AIV, Apolipoprotein A4, Apolipoprotein A-IV |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
ab 365,00 €
Anti-apolipoprotein A-IV, Internal
Artikelnummer: ARG64755.100
Protein function: May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II, potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons. [The UniProt Consortium]
| Schlagworte: | Anti-Apoa4, Anti-Apo-AIV, Anti-ApoA-IV, Anti-Apolipoprotein A4, Anti-Apolipoprotein A-IV |
| Anwendung: | ELISA, IHC (paraffin) |
| Wirt: | Goat |
| Spezies-Reaktivität: | mouse |
784,00 €
Anti-Apoa4
Artikelnummer: NSJ-R35257-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Apolipoprotein A-IV Protein function: May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II, potent activator of...
| Schlagworte: | Anti-Apoa4, Anti-ApoA-IV, Anti-Apo-AIV, Anti-Apolipoprotein A4, Anti-Apolipoprotein A-IV, Apoa4 Antibody |
| Anwendung: | IHC, ELISA (peptide) |
| Wirt: | Goat |
| Spezies-Reaktivität: | mouse |
755,00 €
Apoa4, Mouse apolipoprotein A-IV, Real Time PCR Primer Set
Artikelnummer: VMPS-370
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Apoa4, mCG_10969, Apolipoprotein A-IV |
| Anwendung: | RNA quantification |
43,00 €
Apolipoprotein A4 (APOA4) BioAssay(TM) ELISA Kit (Mouse)
Artikelnummer: 023502.96
Apolipoprotein A4 (APOA4) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of APOA4 in mouse serum, plasma and other biological fluids. Detection Range: 0.156-10ng/ml, Sensitivity: 0.052ng/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...
| Schlagworte: | Apoa4, ApoA-IV, Apo-AIV, Apolipoprotein A4, Apolipoprotein A-IV |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
987,00 €
Apolipoprotein A4 (APOA4) Recombinant, Mouse
Artikelnummer: 153563.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P06728, Fragment: Gln299~Ala369 (Accession No: P06728), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-QV EEFRRTVEPM GEMFNKALVQ QLEQFRQQLG PNSGEVESHL SFLEKSLREK VNSFMSTLEK...
ab 370,00 €
Apolipoprotein A4 (APOA4) Recombinant, Mouse
Artikelnummer: 153564.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P06728, Fragment: Leu135~Asn281 (Accession No: P06728), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-LKPYAV DLQDQINTQT QEMKLQLTPY IQRMQTTIKE NVDNLHTSMM PLATNLKDKF NRNMEELKGH...
ab 370,00 €
Apolipoprotein A4 (APOA4) High Sensitivity BioAssay(TM)...
Artikelnummer: 517001.96
Sample Type:, Serum, plasma and other biological fluids, Intended Use: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of APOA4 in mouse serum, plasma and other biological fluids. Sensitivity: 2.7pg/ml, Range: 7.8-500pg/ml, Specificity: This assay has high sensitivity and excellent...
| Schlagworte: | Apoa4, ApoA-IV, Apo-AIV, Apolipoprotein A4, Apolipoprotein A-IV |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.043,00 €
Anti-Apoa4
Artikelnummer: G-PACO24990.50
Apoa4 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA applications. Apoa4 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient...
| Schlagworte: | Anti-Apoa4, Anti-Apo-AIV, Anti-ApoA-IV, Anti-Apolipoprotein A4, Anti-Apolipoprotein A-IV |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
363,00 €
ApoA4, Recombinant, Mouse, aa21-395, GST-Tag...
Artikelnummer: 372292.100
May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II, potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons. Source: Recombinant protein corresponding to aa21-395 from mouse Apoa4, fused to GST-Tag at...
| Schlagworte: | Apoa4, Apo-AIV, ApoA-IV, Apolipoprotein A4, Apolipoprotein A-IV |
| MW: | 704 |
ab 575,00 €
APOA4, Recombinant, Mouse, aa21-395, His-Tag...
Artikelnummer: 372293.100
May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II, potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons. Source: Recombinant protein corresponding to aa21-395 from mouse Apolipoprotein A-IV, fused to His-Tag...
| Schlagworte: | Apoa4, Apo-AIV, ApoA-IV, Apolipoprotein A4, Apolipoprotein A-IV |
| MW: | 45 |
ab 537,00 €