- Suchergebnis für P06340
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P06340" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA045038.100
Protein function: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B- cells. Modifies peptide exchange activity of HLA-DM. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest...
| Schlagworte: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: CSB-PA002934.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-HLA-DNA, Anti-HLA-DOA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 126,00 €
Artikelnummer: CSB-PA113671.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-HLA-DNA, Anti-HLA-DOA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
284,00 €
Artikelnummer: ATA-HPA076922.100
Polyclonal Antibody against Human HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Validated applications: IHC, Uniprot ID: P06340, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Schlagworte: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: VHPS-4155
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | MHC DZ alpha, MHC DN-alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha chain |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ATA-APrEST83887.100
Protein function: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B- cells. Modifies peptide exchange activity of HLA-DM. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | HLA-DOA, HLA-DNA, MHC DZ alpha, MHC DN-alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: G-CAB15277.20
Protein function: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B- cells. Modifies peptide exchange activity of HLA-DM. [The UniProt Consortium]
| Schlagworte: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
149,00 €
Artikelnummer: ABD-8C16218.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-HLA-DOA with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
628,00 €
Artikelnummer: ELK-ES2536.100
HLA-DOA belongs to the HLA class II alpha chain paralogues. HLA-DOA forms a heterodimer with HLA-DOB. The heterodimer, HLA-DO, is found in lysosomes in B cells and regulates HLA-DM-mediated peptide loading on MHC class II molecules. In comparison with classical HLA class II molecules, this gene exhibits very little...
| Schlagworte: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | WB, IHC, IF, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 173,00 €
Artikelnummer: CSB-CL356784HU.10
Length: 753 Sequence: atggccctca gagcagggct ggtcctgggg ttccacaccc tgatgaccct cctgagcccg caggaggcag gggccaccaa ggctgaccac atgggctcct acggacccgc cttctaccag tcttacggcg cctcgggcca gttcacccat gaatttgatg aggaacagct gttctctgtg gacctgaaga aaagcgaggc cgtgtggcgt ctgcctgagt ttggcgactt tgcccgcttt gacccgcagg gcgggctggc...
| Schlagworte: | HLA-DNA, HLA-DOA, MHC DN-alpha, MHC DZ alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Artikelnummer: CSB-PA356784ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: HLA-DOA. Antigen Species: Human
| Schlagworte: | Anti-HLA-DNA, Anti-HLA-DOA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: ATA-APrEST95717.100
PrEST Antigen HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Antigen sequence: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Schlagworte: | HLA-DOA, HLA-DNA, MHC DN-alpha, MHC DZ alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €