Zu "P06340" wurden 12 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-HLA-DOA
Artikelnummer: ATA-HPA045038.100
Protein function: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B- cells. Modifies peptide exchange activity of HLA-DM. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest...
| Schlagworte: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-HLA-DOA
Artikelnummer: CSB-PA002934.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-HLA-DNA, Anti-HLA-DOA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 126,00 €
Anti-HLA-DOA
Artikelnummer: CSB-PA113671.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-HLA-DNA, Anti-HLA-DOA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
284,00 €
Anti-HLA-DOA
Artikelnummer: ATA-HPA076922.100
Polyclonal Antibody against Human HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Validated applications: IHC, Uniprot ID: P06340, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Schlagworte: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
HLA-DOA, Human major histocompatibility complex, class...
Artikelnummer: VHPS-4155
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | MHC DZ alpha, MHC DN-alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha chain |
| Anwendung: | RNA quantification |
45,00 €
HLA-DOA PrEST Antigen
Artikelnummer: ATA-APrEST83887.100
Protein function: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B- cells. Modifies peptide exchange activity of HLA-DM. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | HLA-DOA, HLA-DNA, MHC DZ alpha, MHC DN-alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-HLA-DOA
Artikelnummer: G-CAB15277.20
Protein function: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B- cells. Modifies peptide exchange activity of HLA-DM. [The UniProt Consortium]
| Schlagworte: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
149,00 €
Anti-HLA-DOA
Artikelnummer: ABD-8C16218.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-HLA-DOA with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
628,00 €
Anti-HLA-DOalpha
Artikelnummer: ELK-ES2536.100
HLA-DOA belongs to the HLA class II alpha chain paralogues. HLA-DOA forms a heterodimer with HLA-DOB. The heterodimer, HLA-DO, is found in lysosomes in B cells and regulates HLA-DM-mediated peptide loading on MHC class II molecules. In comparison with classical HLA class II molecules, this gene exhibits very little...
| Schlagworte: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | WB, IHC, IF, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 173,00 €
HLA-DOA (Vector Vector will be determined during the...
Artikelnummer: CSB-CL356784HU.10
Length: 753 Sequence: atggccctca gagcagggct ggtcctgggg ttccacaccc tgatgaccct cctgagcccg caggaggcag gggccaccaa ggctgaccac atgggctcct acggacccgc cttctaccag tcttacggcg cctcgggcca gttcacccat gaatttgatg aggaacagct gttctctgtg gacctgaaga aaagcgaggc cgtgtggcgt ctgcctgagt ttggcgactt tgcccgcttt gacccgcagg gcgggctggc...
| Schlagworte: | HLA-DNA, HLA-DOA, MHC DN-alpha, MHC DZ alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Anti-HLA-DOA
Artikelnummer: CSB-PA356784ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: HLA-DOA. Antigen Species: Human
| Schlagworte: | Anti-HLA-DNA, Anti-HLA-DOA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
HLA-DOA PrEST Antigen
Artikelnummer: ATA-APrEST95717.100
PrEST Antigen HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Antigen sequence: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Schlagworte: | HLA-DOA, HLA-DNA, MHC DN-alpha, MHC DZ alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €