Zu "P05366" wurden 5 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
-20 %
Angebot
Mouse serum Amyloid A ELISA Kit
Mouse serum Amyloid A ELISA Kit

Artikelnummer: ARG81841.96

Protein function: Major acute phase protein. [The UniProt Consortium]
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Reaktivität: Mouse
732,00 € 585,60 €
Bewerten
+ Gratis T-Shirt
Mouse SAA ELISA Kit
Mouse SAA ELISA Kit

Artikelnummer: KOA0689

Natural and recombinant mouse SAA. There is no detectable cross-reactivity with other relevant proteins. Serum amyloid A protein(SAA), also known as SAA1, is a protein that in humans is encoded by the SAA1 gene. This gene encodes a member of the serum amyloid A family of apolipoproteins. It is mapped to 11p15.1. SAA...
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Reaktivität: Mouse
613,00 €
Bewerten
Serum Amyloid A (SAA) Recombinant, Mouse
Serum Amyloid A (SAA) Recombinant, Mouse

Artikelnummer: 156776.10

Accession Number: P05366/
ab 321,00 €
Bewerten
Mouse SAA (Serum amyloid A) CLIA Kit
Mouse SAA (Serum amyloid A) CLIA Kit

Artikelnummer: E-CL-M0607.96

Type: Sandwich. Detection Range: 0.31~20ng/mL. Sensitivity: 0.19ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA . Standards or samples are...
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: CLIA
Reaktivität: Mouse
658,00 €
Bewerten
Saa1, Recombinant, Mouse, aa20-122, His-SUMO-Tag (Serum Amyloid A-1 Protein)
Saa1, Recombinant, Mouse, aa20-122, His-SUMO-Tag (Serum...

Artikelnummer: 375189.10

Major acute phase protein. Source: Recombinant protein corresponding to aa20-122 from mouse Saa1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY, Storage and...
Schlagworte: Saa1, Serum amyloid A-1 protein
MW: 27,8
ab 406,00 €
Bewerten