- Suchergebnis für P05366
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P05366" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ELK-ELK1625.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse SAA. Next,...
Schlagworte: | Saa1, Serum amyloid A-1 protein |
Anwendung: | ELISA |
Spezies-Reaktivität: | mouse |
ab 365,00 €
Artikelnummer: E-CL-M0607.96
Type: Sandwich. Detection Range: 0.31~20ng/mL. Sensitivity: 0.19ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA . Standards or samples are...
Schlagworte: | Saa1, Serum amyloid A-1 protein |
Anwendung: | CLIA |
Spezies-Reaktivität: | mouse |
541,00 €
Artikelnummer: ARG81841.96
Protein function: Major acute phase protein. [The UniProt Consortium]
Schlagworte: | Saa1, Serum amyloid A-1 protein |
Anwendung: | ELISA |
Spezies-Reaktivität: | mouse |
1.048,00 €
Artikelnummer: E-CL-M0607.24
Type: Sandwich. Detection Range: 0.31~20ng/mL. Sensitivity: 0.19ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA . Standards or samples are...
Schlagworte: | Saa1, Serum amyloid A-1 protein |
Anwendung: | CLIA |
Spezies-Reaktivität: | mouse |
ab 142,00 €
Artikelnummer: KOA0689
Natural and recombinant mouse SAA. There is no detectable cross-reactivity with other relevant proteins. Serum amyloid A protein(SAA), also known as SAA1, is a protein that in humans is encoded by the SAA1 gene. This gene encodes a member of the serum amyloid A family of apolipoproteins. It is mapped to 11p15.1. SAA...
Schlagworte: | Saa1, Serum amyloid A-1 protein |
Anwendung: | ELISA |
Wirt: | Mouse |
Spezies-Reaktivität: | mouse |
848,00 €
Artikelnummer: 156776.10
Accession Number: P05366/
ab 387,00 €
Artikelnummer: 384316.96
Sample Type:, Serum, Plasma, Biological Fluids, Intended Use: This BioAssay(TM) kit is a sandwich ELISA for in vitro quantitative measurement of SAA in Mouse serum, plasma and other biological fluids, Sensitivity: 0.938ng/mL, Range: 1.563-100ng/mL, Specificity: Mouse, Test Principle: This BioAssay(TM) ELISA kit uses...
Schlagworte: | Saa1, Serum amyloid A-1 protein |
Anwendung: | ELISA |
Spezies-Reaktivität: | mouse |
909,00 €
Artikelnummer: 517642.96
Specificity:, This assay has high sensitivity and excellent specificity for detection of Serum Amyloid A (SAA). No significant cross-reactivity or interference between Serum Amyloid A (SAA) and analogues was observed. Precision: Intra-Assay: CV<10% , Inter-Assay: CV<12%, Kit Components: 96-well strip plate, 1x Plate...
Schlagworte: | Saa1, Serum amyloid A-1 protein |
Anwendung: | ELISA |
Spezies-Reaktivität: | mouse |
939,00 €
Artikelnummer: 375189.100
Major acute phase protein. Source: Recombinant protein corresponding to aa20-122 from mouse Saa1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY, Storage and...
Schlagworte: | Saa1, Serum amyloid A-1 protein |
MW: | 27,8 |
ab 575,00 €