Zu "P05366" wurden 18 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Mouse serum Amyloid A ELISA Kit
Artikelnummer: ARG81841.96
Protein function: Major acute phase protein. [The UniProt Consortium]
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.118,00 €
Serum amyloid A-1 protein (Saa1), mouse, recombinant
Artikelnummer: CSB-EP020656MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 20-122aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: GFFSFVHEAF QGAGDMWRAY TDMKEANWKN SDKYFHARGN YDAAQRGPGG VWAAEKISDG REAFQEFFGR GHEDTIADQE ANRHGRSGKD PNYYRPPGLP DKY. Purity:...
| Schlagworte: | Saa1, Serum amyloid A-1 protein, Recombinant Mouse Serum amyloid A-1 protein (Saa1) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 27.8 kD |
ab 292,00 €
Serum amyloid A-1 protein (Saa1), mouse, recombinant
Artikelnummer: CSB-EP020656MOa0.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 20-122aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GFFSFVHEAF QGAGDMWRAY TDMKEANWKN SDKYFHARGN YDAAQRGPGG VWAAEKISDG REAFQEFFGR GHEDTIADQE ANRHGRSGKD PNYYRPPGLP DKY. Purity: Greater...
| Schlagworte: | Saa1, Serum amyloid A-1 protein, Recombinant Mouse Serum amyloid A-1 protein (Saa1) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 17 kD |
ab 292,00 €
SAA1 Protein, Mouse, Recombinant (His)
Artikelnummer: TGM-TMPH-02900-100ug
Description: Major acute phase protein. SAA1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17 kDa and the accession number is P05366.
| Schlagworte: | Serum amyloid A-1 protein, Saa1 |
| MW: | 17 kD |
ab 266,00 €
NEU
Mouse SAA (Serum Amyloid A) ELISA Kit
Artikelnummer: G-AEKE04203.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse SAA. Next,...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
694,00 €
NEU
Mouse SAA (Serum Amyloid A ) Superset Max DIY ELISA
Artikelnummer: G-AEES05482.480
Mouse SAA (Serum Amyloid A ) Superset Max DIY ELISA Protein Function: Major acute phase protein [The Uniprot Consortium]
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
919,00 €
NEU
SAA1 Protein, Mouse, Recombinant (His)
Artikelnummer: TGM-TMPH-02900-10ug
Description: Major acute phase protein. SAA1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17 kDa and the accession number is P05366.
| Schlagworte: | Saa1 , Serum amyloid A-1 protein |
| MW: | 17 kD |
ab 99,00 €
-10 %
Rabattaktion
Mini Sample Mouse SAA ( Serum Amyloid A ) ELISA Kit
Artikelnummer: E-MSEL-M0091.24
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
122,00 €
109,80 €
Saa1, Recombinant, Mouse, aa20-122, His-SUMO-Tag (Serum...
Artikelnummer: 375189.100
Major acute phase protein. Source: Recombinant protein corresponding to aa20-122 from mouse Saa1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY, Storage and...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| MW: | 27,8 |
ab 690,00 €
Mouse serum amyloid A1 (SAA1) ELISA kit
Artikelnummer: CSB-EL020656MO.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 3.12 ng/ml - 200 ng/ml Sensitivity: 0.78 ng/ml Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Major acute phase protein. [The UniProt Consortium]
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | mouse |
ab 581,00 €
Mouse SAA(Serum Amyloid A) ELISA Kit
Artikelnummer: ELK-ELK10304.48
Major acute phase protein Assay Type: Sandwich. Sensitivity: 2.67 ng/mL. Standard: 500 ng/mL. Detection range: 7.81-500 ng/mL. Sample type: serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Assay length: 3.5h. Research Field: Infection immunity,Kidney...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
ab 374,00 €
Serum Amyloid A (SAA) BioAssay(TM) ELISA Kit (Mouse)
Artikelnummer: 517642.96
Specificity:, This assay has high sensitivity and excellent specificity for detection of Serum Amyloid A (SAA). No significant cross-reactivity or interference between Serum Amyloid A (SAA) and analogues was observed. Precision: Intra-Assay: CV<10% , Inter-Assay: CV<12%, Kit Components: 96-well strip plate, 1x Plate...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.065,00 €