- Suchergebnis für P04640
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P04640" wurden 23 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: NSJ-R32433
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Osteocalcin, also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP), is a noncollagenous protein found in bone and dentin. In humans, the osteocalcin is encoded by the BGLAP gene. Its receptor is GPRC6A. It is mapped to 1q22. Osteocalcin may...
| Schlagworte: | Anti-BGP, Anti-Bglap, Anti-Bglap2, Anti-Osteocalcin, Anti-Bone Gla protein, Anti-Gamma-carboxyglutamic acid-containing... |
| Anwendung: | IHC (paraffin), FC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | rat |
790,00 €
Artikelnummer: E-CL-R0169.96
Type: Sandwich. Detection Range: 0.16~10ng/mL. Sensitivity: 0.09ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat OC/BGP . Standards or samples...
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Anwendung: | CLIA |
| Spezies-Reaktivität: | rat |
553,00 €
Artikelnummer: ARG59341.50
Protein function: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. [The UniProt Consortium]
| Schlagworte: | Anti-BGP, Anti-Bglap, Anti-Bglap2, Anti-Osteocalcin, Anti-Bone Gla protein, Anti-Gamma-carboxyglutamic acid-containing... |
| Anwendung: | FC, IHC (paraffin) |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | rat |
551,00 €
Artikelnummer: ELK-ELK2391.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat OC. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat OC. Next, Avidin...
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 374,00 €
Artikelnummer: CSB-EP002682RA.1
Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 50-99aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: YLNNGLGAPA PYPDPLEPHR EVCELNPNCD ELADHIGFQD AYKRIYGTTV. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, Recombinant Rat... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
| MW: | 32.6 kD |
ab 292,00 €
Artikelnummer: TGM-TMPH-03346-100ug
Description: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Osteocalcin Protein, Rat, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 32.6 kDa and the accession number is P04640.
| Schlagworte: | Gamma-carboxyglutamic acid-containing protein, Bglap, Osteocalcin, Bone Gla protein |
| MW: | 32.6 kD |
ab 266,00 €
Artikelnummer: E-PDER100164.1
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
| Schlagworte: | Bglap, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, Recombinant Rat OC/BGP... |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
ab 192,00 €
NEU
Artikelnummer: G-AEKE06645.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat OC. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat OC. Next, Avidin...
| Schlagworte: | Bglap, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
694,00 €
Artikelnummer: 370728.100
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Source: Recombinant protein corresponding to aa50-99 from rat Bglap, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33kD, AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV, Storage and...
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| MW: | 33 |
ab 690,00 €
Artikelnummer: E-EL-R3070.24
Type: Sandwich-ELISA. Detection Range: 31.25-2000 pg/mL. Sensitivity: 45.49 pg/mL. Tested Sample Types: Serum, plasma and other biological fluids. Test principle: This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to OC/BGP ....
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 122,00 €
Artikelnummer: CSB-E05129r.48
Sample Types: serum, plasma, tissue homogenates. Detection Range: 125 pg/mL- 8000 pg/mL Sensitivity: 31.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Constitutes 1-2% of the total bone protein. It binds strongly to...
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | rat |
ab 711,00 €