Zu "P04640" wurden 23 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-Osteocalcin
Anti-Osteocalcin

Artikelnummer: NSJ-R32433

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Osteocalcin, also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP), is a noncollagenous protein found in bone and dentin. In humans, the osteocalcin is encoded by the BGLAP gene. Its receptor is GPRC6A. It is mapped to 1q22. Osteocalcin may...
Schlagworte: Anti-BGP, Anti-Bglap, Anti-Bglap2, Anti-Osteocalcin, Anti-Bone Gla protein, Anti-Gamma-carboxyglutamic acid-containing...
Anwendung: IHC (paraffin), FC
Wirt: Rabbit
Spezies-Reaktivität: rat
790,00 €
Bewerten
Rat OC/BGP (Osteocalcin) CLIA Kit
Rat OC/BGP (Osteocalcin) CLIA Kit

Artikelnummer: E-CL-R0169.96

Type: Sandwich. Detection Range: 0.16~10ng/mL. Sensitivity: 0.09ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat OC/BGP . Standards or samples...
Schlagworte: BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein
Anwendung: CLIA
Spezies-Reaktivität: rat
553,00 €
Bewerten
Anti-Osteocalcin
Anti-Osteocalcin

Artikelnummer: ARG59341.50

Protein function: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. [The UniProt Consortium]
Schlagworte: Anti-BGP, Anti-Bglap, Anti-Bglap2, Anti-Osteocalcin, Anti-Bone Gla protein, Anti-Gamma-carboxyglutamic acid-containing...
Anwendung: FC, IHC (paraffin)
Wirt: Rabbit
Spezies-Reaktivität: rat
551,00 €
Bewerten
Rat OC (Osteocalcin) ELISA Kit
Rat OC (Osteocalcin) ELISA Kit

Artikelnummer: ELK-ELK2391.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat OC. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat OC. Next, Avidin...
Schlagworte: BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein
Anwendung: ELISA
Spezies-Reaktivität: rat
ab 374,00 €
Bewerten
Osteocalcin (Bglap), rat, recombinant
Osteocalcin (Bglap), rat, recombinant

Artikelnummer: CSB-EP002682RA.1

Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 50-99aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: YLNNGLGAPA PYPDPLEPHR EVCELNPNCD ELADHIGFQD AYKRIYGTTV. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
Schlagworte: BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, Recombinant Rat...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: rat
MW: 32.6 kD
ab 292,00 €
Bewerten
Osteocalcin Protein, Rat, Recombinant (GST)
Osteocalcin Protein, Rat, Recombinant (GST)

Artikelnummer: TGM-TMPH-03346-100ug

Description: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Osteocalcin Protein, Rat, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 32.6 kDa and the accession number is P04640.
Schlagworte: Gamma-carboxyglutamic acid-containing protein, Bglap, Osteocalcin, Bone Gla protein
MW: 32.6 kD
ab 266,00 €
Bewerten
Recombinant Rat OC/BGP protein(His&SUMO tag)
Recombinant Rat OC/BGP protein(His&SUMO tag)

Artikelnummer: E-PDER100164.1

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Schlagworte: Bglap, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, Recombinant Rat OC/BGP...
Exprimiert in: E.coli
Ursprungsart: rat
ab 192,00 €
Bewerten
NEU
Rat OC (Osteocalcin) ELISA Kit
Rat OC (Osteocalcin) ELISA Kit

Artikelnummer: G-AEKE06645.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat OC. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat OC. Next, Avidin...
Schlagworte: Bglap, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein
Anwendung: ELISA
Spezies-Reaktivität: rat
694,00 €
Bewerten
Osteocalcin, Recombinant, Rat, aa50-99, GST-Tag (Bglap)
Osteocalcin, Recombinant, Rat, aa50-99, GST-Tag (Bglap)

Artikelnummer: 370728.100

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Source: Recombinant protein corresponding to aa50-99 from rat Bglap, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33kD, AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV, Storage and...
Schlagworte: BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein
MW: 33
ab 690,00 €
Bewerten
Rat OC/BGP (Osteocalcin) ELISA Kit
Rat OC/BGP (Osteocalcin) ELISA Kit

Artikelnummer: E-EL-R3070.24

Type: Sandwich-ELISA. Detection Range: 31.25-2000 pg/mL. Sensitivity: 45.49 pg/mL. Tested Sample Types: Serum, plasma and other biological fluids. Test principle: This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to OC/BGP ....
Schlagworte: BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein
Anwendung: ELISA
Spezies-Reaktivität: rat
ab 122,00 €
Bewerten
Rat Osteocalcin/Bone gla protein, OT/BGP ELISA kit
Rat Osteocalcin/Bone gla protein, OT/BGP ELISA kit

Artikelnummer: CSB-E05129r.48

Sample Types: serum, plasma, tissue homogenates. Detection Range: 125 pg/mL- 8000 pg/mL Sensitivity: 31.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Constitutes 1-2% of the total bone protein. It binds strongly to...
Schlagworte: BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein
Anwendung: ELISA, Sandwich ELISA
Spezies-Reaktivität: rat
ab 711,00 €
Bewerten
Osteocalcin (OC) Recombinant, Rat
Osteocalcin (OC) Recombinant, Rat

Artikelnummer: 156194.10

Accession Number: P04640/
ab 434,00 €
Bewerten
1 von 2 Seiten