Zu "P04089" wurden 12 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Rat PTH / Parathyroid Hormone (1-34) ELISA Kit
Rat PTH / Parathyroid Hormone (1-34) ELISA Kit

Artikelnummer: ARG82254.96

Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2- deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]
Schlagworte: Pth, PTH, Parathyrin, Parathyroid hormone
Anwendung: ELISA
Spezies-Reaktivität: rat
1.850,00 €
Bewerten
I-PTH (rat), recombinant protein (Trx Tag)
I-PTH (rat), recombinant protein (Trx Tag)

Artikelnummer: E-PDER100658.1

Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]
Schlagworte: PTH, Pth, Parathyrin, Parathyroid hormone, Recombinant Rat I-PTH Protein(Trx Tag)
Exprimiert in: E.coli
Ursprungsart: rat
ab 192,00 €
Bewerten
Recombinant Rat I-PTH Protein(Trx Tag)
Recombinant Rat I-PTH Protein(Trx Tag)

Artikelnummer: E-PDER100113.1

PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
Schlagworte: Pth, Parathyrin, Parathyroid hormone, Recombinant Rat I-PTH Protein(Trx Tag)
ab 192,00 €
Bewerten
Rat Parathyroid hormone, PTH ELISA Kit
Rat Parathyroid hormone, PTH ELISA Kit

Artikelnummer: CSB-E07866r.48

Sample Types: serum, plasma, tissue homogenates Detection Range: 6.25 pg/mL-400 pg/mL Sensitivity: 1.56 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: PTH elevates calcium level by dissolving the salts in bone and...
Schlagworte: Pth, PTH, Parathyrin, Parathyroid hormone
Anwendung: ELISA, Sandwich ELISA
Spezies-Reaktivität: rat
ab 711,00 €
Bewerten
Parathyroid hormone (pTH) Rat 39-84 peptide
Parathyroid hormone (pTH) Rat 39-84 peptide

Artikelnummer: 000-001-M31

Greater than 95% specific peptide. Parathyroid hormone (pTH) is the most important endocrine regulator of Ca2+ and phosphorus concentration in the extracellular fluid. pTH is secreted from cells of the parathyroid glands and acts for the most part via the binding to specific G-protein coupled receptors on the...
Schlagworte: Pth, PTH, Parathyrin, Parathyroid hormone
634,00 €
Bewerten
Parathyroid hormone (pTH) Rat 7-34 peptide
Parathyroid hormone (pTH) Rat 7-34 peptide

Artikelnummer: 000-001-M32

Greater than 95% specific peptide. Parathyroid hormone (pTH) is the most important endocrine regulator of Ca2+ and phosphorus concentration in the extracellular fluid. pTH is secreted from cells of the parathyroid glands and acts for the most part via the binding to specific G-protein coupled receptors on the...
Schlagworte: Pth, PTH, Parathyrin, Parathyroid hormone
472,00 €
Bewerten
Pth, Rat parathyroid hormone, Real Time PCR Primer Set
Pth, Rat parathyroid hormone, Real Time PCR Primer Set

Artikelnummer: VRPS-4911

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: PTH, Pth, Parathyrin, Parathyroid hormone
Anwendung: RNA quantification
54,00 €
Bewerten
Parathyroid Hormone, Rat, aa1-34 (PTH, Parathyrin)
Parathyroid Hormone, Rat, aa1-34 (PTH, Parathyrin)

Artikelnummer: 298235.1

PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity). Source: Synthetic rat PTH , AA Sequence: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF, Storage and Stability:...
Schlagworte: Pth, PTH, Parathyrin, Parathyroid hormone
Ursprungsart: rat
ab 477,00 €
Bewerten
Rat PTH ELISA Kit
Rat PTH ELISA Kit

Artikelnummer: G-RTFI00259.96

Anwendung: ELISA
Spezies-Reaktivität: rat
698,00 €
Bewerten
Rat I-PTH (Intact Parathormone) ELISA Kit
Rat I-PTH (Intact Parathormone) ELISA Kit

Artikelnummer: G-AEES00445.96

ELISA Type: Sandwich. Detection Range: 15.63-1000µg/mL. Sensitivity: 9.38µg/mL. Sample Types: Serum, plasma and other biological fluids. Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and...
Schlagworte: PTH, Pth, Parathyrin, Parathyroid hormone
Anwendung: Sandwich
Spezies-Reaktivität: rat
708,00 €
Bewerten
Anti-Pth
Anti-Pth

Artikelnummer: CSB-PA018987ZA01RA.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-PTH, Anti-Pth, Anti-Parathyrin, Anti-Parathyroid hormone, Pth Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Rattus norvegicus (Rat)
ab 1.529,00 €
Bewerten
I-PTH Protein (Trx Tag) (recombinant rat)
I-PTH Protein (Trx Tag) (recombinant rat)

Artikelnummer: G-RPES8228.20

Endotoxin level: < 10 EU/mg of the protein as determined by the LAL method. Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]
Schlagworte: Pth, PTH, Parathyrin, Parathyroid hormone
Exprimiert in: E.coli
Ursprungsart: rat
306,00 €
Bewerten