- Suchergebnis für P03969
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P03969" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
NEU
Artikelnummer: TGM-TMPS-00032-100ug
Description: FGF-2 Protein, Bovine, Recombinant is expressed in E. coli. The accession number is P03969.
| Schlagworte: | BFGF , bFGF , HBGF-2 , Prostatropin , FGFB , FGF-2 , Fibroblast Growth Factor-basic |
| MW: | 16.4 kD |
ab 51,00 €
Artikelnummer: 87379.10
The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors. (www.uniprot.org) Produced in E.coli. Single, non-glycosylated, polypeptide chain containing 155...
| Schlagworte: | HBGH-2, HBGF-2, Prostatropin, FGF-2, FGB-b |
| Anwendung: | Cell Culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | bovine |
| MW: | 17250.00 D |
ab 105,00 €
Artikelnummer: 009-001-U82-0010
Fibroblast Growth Factor 147 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Schlagworte: | FGF2 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
186,00 €
Artikelnummer: 009-001-U82-0050
Fibroblast Growth Factor 147 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Schlagworte: | FGF2 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
445,00 €
Artikelnummer: 009-001-U84-0010
Hu Fibroblast Growth Factor 154 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-PAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Schlagworte: | FGF2 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
186,00 €
Artikelnummer: 009-001-U84-0050
Fibroblast Growth Factor 154 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Schlagworte: | FGF2 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
445,00 €
Artikelnummer: Cay24760-1
Brain-derived basic fibroblast growth factor (1-24) (brain-derived bFGF) is a peptide fragment of brain-derived bFGF. bFGF is a peptide produced in bovine brain that is protective in a rat model of pressure-induced retinal ischemia. bFGF (1-24) corresponds to amino acid residues 1-24 of the full length...
| Schlagworte: | Brain-Derived bFGF (1-24) (bovine),... |
| Anwendung: | Peptide fragment |
| MW: | 2553.8 D |
190,00 €
Artikelnummer: ELK-ELK7546.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Cattle FGF2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Cattle FGF2. Next,...
| Schlagworte: | FGF2 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | cattle |
ab 481,00 €
Artikelnummer: CSB-YP008625BO.1
Organism: Bos taurus (Bovine). Source: Yeast. Expression Region: 10-155aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: PALPEDGGSG AFPPGHFKDP KRLYCKNGGF FLRIHPDGRV DGVREKSDPH IKLQLQAEER GVVSIKGVCA NRYLAMKEDG RLLASKCVTD ECFFFERLES NNYNTYRSRK YSSWYVALKR...
| Schlagworte: | FGF2, Recombinant Bovine Fibroblast growth factor 2 (FGF2) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | bovine |
| MW: | 18.4 kD |
ab 407,00 €
Artikelnummer: CSB-EP008625BO.1
Organism: Bos taurus (Bovine). Source: E.coli. Expression Region: 10-155aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: PALPEDGGSG AFPPGHFKDP KRLYCKNGGF FLRIHPDGRV DGVREKSDPH IKLQLQAEER GVVSIKGVCA NRYLAMKEDG RLLASKCVTD ECFFFERLES NNYNTYRSRK YSSWYVALKR...
| Schlagworte: | FGF2, Recombinant Bovine Fibroblast growth factor 2 (FGF2) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | bovine |
| MW: | 20.5 kD |
ab 364,00 €
NEU
Artikelnummer: GSC-Z03230-1
Fibroblast Growth Factor-basic (FGF-basic), also known as FGF-2, is a pleiotropic cytokine and one of the prototypic members of the heparin-binding FGF family. Like other FGF family members, FGF-basic has the beta trefoil structure. In vivo, FGF-basic is produced by a variety of cells, including cardiomycotes,...
| Schlagworte: | FGF2, Fibroblast growth factor 2, Basic fibroblast growth factor, Heparin-binding growth factor 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | bovine |
ab 67,00 €
Artikelnummer: E-PKSS000016.20
Activity: Measure by its ability to induce proliferation in 3T3 cells. The ED50 for this effect is <2 ng/mL. Sequence: MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS. Fusion tag: N-His Endotoxin: Please...
| Schlagworte: | FGF2, Recombinant Swine FGF-2 protein(N-His)(active) |
| Anwendung: | Active, cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 18.07 kD |
ab 192,00 €