Zu "P03969" wurden 16 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
NEU
FGF-2 Protein, Bovine, Recombinant
Artikelnummer: TGM-TMPS-00032-100ug
Description: FGF-2 Protein, Bovine, Recombinant is expressed in E. coli. The accession number is P03969.
| Schlagworte: | BFGF , bFGF , HBGF-2 , Prostatropin , FGFB , FGF-2 , Fibroblast Growth Factor-basic |
| MW: | 16.4 kD |
ab 51,00 €
Fibroblast Growth Factor basic, bovine recombinant...
Artikelnummer: 87379.10
The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors. (www.uniprot.org) Produced in E.coli. Single, non-glycosylated, polypeptide chain containing 155...
| Schlagworte: | HBGH-2, HBGF-2, Prostatropin, FGF-2, FGB-b |
| Anwendung: | Cell Culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | bovine |
| MW: | 17250.00 D |
ab 105,00 €
Fibroblast Growth Factor 147 basic
Artikelnummer: 009-001-U82-0010
Fibroblast Growth Factor 147 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Schlagworte: | FGF2 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
186,00 €
Fibroblast Growth Factor 147 basic
Artikelnummer: 009-001-U82-0050
Fibroblast Growth Factor 147 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Schlagworte: | FGF2 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
445,00 €
Fibroblast Growth Factor 154 basic
Artikelnummer: 009-001-U84-0010
Hu Fibroblast Growth Factor 154 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-PAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Schlagworte: | FGF2 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
186,00 €
Fibroblast Growth Factor 154 basic
Artikelnummer: 009-001-U84-0050
Fibroblast Growth Factor 154 basic purity was determined to be greater than 97% as determined by analysis by UV-Spectroscopy at 280nm and by reducing and non-reducing SDS-pAGE. Protein function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell...
| Schlagworte: | FGF2 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
445,00 €
Brain-Derived Basic Fibroblast Growth Factor (1-24)...
Artikelnummer: Cay24760-1
Brain-derived basic fibroblast growth factor (1-24) (brain-derived bFGF) is a peptide fragment of brain-derived bFGF. bFGF is a peptide produced in bovine brain that is protective in a rat model of pressure-induced retinal ischemia. bFGF (1-24) corresponds to amino acid residues 1-24 of the full length...
| Schlagworte: | Brain-Derived bFGF (1-24) (bovine),... |
| Anwendung: | Peptide fragment |
| MW: | 2553.8 D |
190,00 €
Cattle FGF2 (Fibroblast Growth Factor 2, Basic) ELISA Kit
Artikelnummer: ELK-ELK7546.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Cattle FGF2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Cattle FGF2. Next,...
| Schlagworte: | FGF2 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | cattle |
ab 481,00 €
Fibroblast growth factor 2 (FGF2), bovine, recombinant
Artikelnummer: CSB-YP008625BO.1
Organism: Bos taurus (Bovine). Source: Yeast. Expression Region: 10-155aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: PALPEDGGSG AFPPGHFKDP KRLYCKNGGF FLRIHPDGRV DGVREKSDPH IKLQLQAEER GVVSIKGVCA NRYLAMKEDG RLLASKCVTD ECFFFERLES NNYNTYRSRK YSSWYVALKR...
| Schlagworte: | FGF2, Recombinant Bovine Fibroblast growth factor 2 (FGF2) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | bovine |
| MW: | 18.4 kD |
ab 407,00 €
Fibroblast growth factor 2 (FGF2), bovine, recombinant
Artikelnummer: CSB-EP008625BO.1
Organism: Bos taurus (Bovine). Source: E.coli. Expression Region: 10-155aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: PALPEDGGSG AFPPGHFKDP KRLYCKNGGF FLRIHPDGRV DGVREKSDPH IKLQLQAEER GVVSIKGVCA NRYLAMKEDG RLLASKCVTD ECFFFERLES NNYNTYRSRK YSSWYVALKR...
| Schlagworte: | FGF2, Recombinant Bovine Fibroblast growth factor 2 (FGF2) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | bovine |
| MW: | 20.5 kD |
ab 364,00 €
NEU
FGF-basic, Bovine
Artikelnummer: GSC-Z03230-1
Fibroblast Growth Factor-basic (FGF-basic), also known as FGF-2, is a pleiotropic cytokine and one of the prototypic members of the heparin-binding FGF family. Like other FGF family members, FGF-basic has the beta trefoil structure. In vivo, FGF-basic is produced by a variety of cells, including cardiomycotes,...
| Schlagworte: | FGF2, Fibroblast growth factor 2, Basic fibroblast growth factor, Heparin-binding growth factor 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | bovine |
ab 67,00 €
FGF-2 protein(N-His)(active) (recombinant swine)
Artikelnummer: E-PKSS000016.20
Activity: Measure by its ability to induce proliferation in 3T3 cells. The ED50 for this effect is <2 ng/mL. Sequence: MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS. Fusion tag: N-His Endotoxin: Please...
| Schlagworte: | FGF2, Recombinant Swine FGF-2 protein(N-His)(active) |
| Anwendung: | Active, cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 18.07 kD |
ab 192,00 €