Zu "P02693" wurden 9 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
FABP2 (rat recombinant)
Artikelnummer: Cay10007938-100
Fatty acid binding protein-2 (FABP2) is one of nine known cytosolic FABPs ranging in size from 14-15 kDa containing 127-132 amino acids. Members of this protein family exhibit high affinity for small lipophilic ligands and were named according to the tissue from which they were initially isolated. Studies suggest...
| Schlagworte: | Fatty Acid Binding Protein 2, I-FABP, Intestinal-FABP |
| Anwendung: | WB |
| MW: | 19,3 kD |
661,00 €
Rat IFABP/FABP2 (Intestinal Fatty Acid Binding Protein)...
Artikelnummer: ELK-ELK2603.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat IFABP/FABP2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat...
| Schlagworte: | Fabp2, Fabpi, I-FABP, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal, Intestinal-type fatty... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 374,00 €
Rat IFABP/FABP2 (Intestinal Fatty Acid Binding Protein)...
Artikelnummer: G-AEKE06850.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat IFABP/FABP2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat...
| Schlagworte: | Fabp2, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal, Intestinal-type fatty acid-binding protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
694,00 €
Rat intestinal fatty acid binding protein, iFABP ELISA Kit
Artikelnummer: CSB-E08026r.48
Sample Types: serum, plasma, urine, tissue homogenates Detection Range: 1.25 ng/mL-80 ng/mL Sensitivity: 0.312 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: FABP are thought to play a role in the intracellular transport...
| Schlagworte: | Fabp2, Fabpi, I-FABP, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal, Intestinal-type fatty... |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | rat |
ab 581,00 €
Fabp2, Rat fatty acid binding protein 2, intestinal, Real...
Artikelnummer: VRPS-1967
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Fabpi, Fabp2, I-FABP, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal, Intestinal-type fatty... |
| Anwendung: | RNA quantification |
54,00 €
Fatty Acid Binding Protein 2, Intestinal (FABP2)...
Artikelnummer: 154504.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P02693, Fragment: Ala2~Glu132 (Accession No: P02693), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-AFDGTWKVD RNENYEKFME KMGINVVKRK LGAHDNLKLT ITQEGNKFTV KESSNFRNID VVFELGVDFA YSLADGTELT...
ab 454,00 €
Rat IFABP / FABP2 ELISA Kit
Artikelnummer: G-RTFI00886.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
698,00 €
Rat IFABP/FABP2 (Intestinal Fatty Acid Binding Protein)...
Artikelnummer: G-AEES00460.96
ELISA Type: Sandwich. Detection Range: 0.16-10µg/mL. Sensitivity: 0.1µg/mL. Sample Types: Serum, plasma and other biological fluids. Protein function: FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich...
| Schlagworte: | Fabp2, Fabpi, I-FABP, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal, Intestinal-type fatty... |
| Anwendung: | Sandwich |
| Spezies-Reaktivität: | rat |
708,00 €
Anti-Fabp2
Artikelnummer: CSB-PA007942XA01RA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-Fabpi, Anti-Fabp2, Anti-I-FABP, Anti-Fatty acid-binding protein 2, Anti-Fatty acid-binding protein, intestinal,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Rattus norvegicus (Rat) |
ab 1.529,00 €