- Suchergebnis für P02693
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P02693" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: Cay10007938-100
Fatty acid binding protein-2 (FABP2) is one of nine known cytosolic FABPs ranging in size from 14-15 kDa containing 127-132 amino acids. Members of this protein family exhibit high affinity for small lipophilic ligands and were named according to the tissue from which they were initially isolated. Studies suggest...
| Schlagworte: | Fatty Acid Binding Protein 2, I-FABP, Intestinal-FABP |
| Anwendung: | WB |
| MW: | 19,3 kD |
661,00 €
Artikelnummer: ELK-ELK2603.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat IFABP/FABP2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat...
| Schlagworte: | Fabp2, Fabpi, I-FABP, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal, Intestinal-type fatty... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 374,00 €
Artikelnummer: G-AEKE06850.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat IFABP/FABP2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat...
| Schlagworte: | Fabp2, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal, Intestinal-type fatty acid-binding protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
694,00 €
Artikelnummer: CSB-E08026r.48
Sample Types: serum, plasma, urine, tissue homogenates Detection Range: 1.25 ng/mL-80 ng/mL Sensitivity: 0.312 ng/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: FABP are thought to play a role in the intracellular transport...
| Schlagworte: | Fabp2, Fabpi, I-FABP, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal, Intestinal-type fatty... |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | rat |
ab 581,00 €
Artikelnummer: VRPS-1967
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Fabpi, Fabp2, I-FABP, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal, Intestinal-type fatty... |
| Anwendung: | RNA quantification |
54,00 €
Artikelnummer: 154504.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P02693, Fragment: Ala2~Glu132 (Accession No: P02693), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-AFDGTWKVD RNENYEKFME KMGINVVKRK LGAHDNLKLT ITQEGNKFTV KESSNFRNID VVFELGVDFA YSLADGTELT...
ab 454,00 €
Artikelnummer: G-RTFI00886.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
698,00 €
Artikelnummer: G-AEES00460.96
ELISA Type: Sandwich. Detection Range: 0.16-10µg/mL. Sensitivity: 0.1µg/mL. Sample Types: Serum, plasma and other biological fluids. Protein function: FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich...
| Schlagworte: | Fabp2, Fabpi, I-FABP, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal, Intestinal-type fatty... |
| Anwendung: | Sandwich |
| Spezies-Reaktivität: | rat |
708,00 €
Artikelnummer: CSB-PA007942XA01RA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-Fabpi, Anti-Fabp2, Anti-I-FABP, Anti-Fatty acid-binding protein 2, Anti-Fatty acid-binding protein, intestinal,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Rattus norvegicus (Rat) |
ab 1.529,00 €