Zu "P01721" wurden 2 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-IGLV6-57
Artikelnummer: ATA-HPA028862.100
Polyclonal Antibody against Human IGLV6-57, Gene description: immunoglobulin lambda variable 6-57, Validated applications: IHC, Uniprot ID: P01721, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: V region of the variable domain of immunoglobulin light...
| Schlagworte: | Anti-Ig lambda chain V-VI region AR, Anti-Ig lambda chain V-VI region WLT, Anti-Ig lambda chain V-VI region EB4, Anti-Ig... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
463,00 €
IGLV6-57 PrEST Antigen
Artikelnummer: ATA-APrEST95900.100
PrEST Antigen IGLV6-57, Gene description: immunoglobulin lambda variable 6-57, Antigen sequence: HSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHTVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: V region of the variable domain...
| Schlagworte: | Ig lambda chain V-VI region AR, Ig lambda chain V-VI region EB4, Ig lambda chain V-VI region WLT, Ig lambda chain V-VI... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
