Zu "P01721" wurden 3 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-IGLV6-57
Anti-IGLV6-57

Artikelnummer: ATA-HPA028862.100

Polyclonal Antibody against Human IGLV6-57, Gene description: immunoglobulin lambda variable 6-57, Validated applications: IHC, Uniprot ID: P01721, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: V region of the variable domain of immunoglobulin light...
Schlagworte: Anti-Ig lambda chain V-VI region AR, Anti-Ig lambda chain V-VI region WLT, Anti-Ig lambda chain V-VI region EB4, Anti-Ig...
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
463,00 €
Bewerten
Anti-IGLV6-57
Anti-IGLV6-57

Artikelnummer: ATA-HPA028862.25

Polyclonal Antibody against Human IGLV6-57, Gene description: immunoglobulin lambda variable 6-57, Validated applications: IHC, Uniprot ID: P01721, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: V region of the variable domain of immunoglobulin light...
Schlagworte: Anti-Ig lambda chain V-VI region AR, Anti-Ig lambda chain V-VI region WLT, Anti-Ig lambda chain V-VI region EB4, Anti-Ig...
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
323,00 €
Bewerten
IGLV6-57 PrEST Antigen
IGLV6-57 PrEST Antigen

Artikelnummer: ATA-APrEST95900.100

PrEST Antigen IGLV6-57, Gene description: immunoglobulin lambda variable 6-57, Antigen sequence: HSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHTVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: V region of the variable domain...
Schlagworte: Ig lambda chain V-VI region AR, Ig lambda chain V-VI region EB4, Ig lambda chain V-VI region WLT, Ig lambda chain V-VI...
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten