- Suchergebnis für O94772
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "O94772" wurden 17 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-PACO28062.50
LY6H Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. LY6H Antibody is a high quality polyclonal antibody for research use only.. Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In...
| Schlagworte: | Anti-LY6H, Anti-Ly-6H, Anti-Lymphocyte antigen 6H |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
313,00 €
Artikelnummer: CSB-YP013249HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 26-115aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LWCQDCTLTT NSSHCTPKQC QPSDTVCASV RITDPSSSRK DHSVNKMCAS SCDFVKRHFF SDYLMGFINS GILKVDVDCC EKDLCNGAAG. Purity: Greater than 90% as...
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H, Recombinant Human Lymphocyte antigen 6H (LY6H) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | human |
| MW: | 11.9 kD |
ab 347,00 €
Artikelnummer: DIM-PME101251.10
Recombinant Human LY6H Protein with C-terminal human Fc tag. LY6H(Leu26-Gly115) hFc(Glu99-Ala330), Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular...
| Schlagworte: | NMLY6 |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| CAS | 12 |
| MW: | 36.0 kD |
ab 116,00 €
Artikelnummer: TGM-TMPJ-00709-10ug
Description: Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is...
| Schlagworte: | Ly-6H, LY6H, Lymphocyte Antigen 6H |
| MW: | 18 kD |
ab 172,00 €
Artikelnummer: TGM-TMPJ-00709-100ug
Description: Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is...
| Schlagworte: | Ly-6H , LY6H , Lymphocyte Antigen 6H |
| MW: | 18 kD |
ab 105,00 €
Artikelnummer: 374099.100
Source:, Recombinant protein corresponding to aa26-115 from human Lymphocyte Antigen 6H, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.9kD, AA Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG, Storage and Stability: May be stored at 4°C...
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| MW: | 11,9 |
ab 692,00 €
Artikelnummer: E-PKSH032715.10
Protein Construction: Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus. Sequence: Leu26-Gly115. Fusion tag: C-6His Endotoxin: < 1.0 EU per µg as determined by the LAL method. Apparent...
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H, Recombinant Human Lymphocyte Antigen 6H/LY6H Protein(C-6His) |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 10.9 kD |
ab 156,00 €
Artikelnummer: VHPS-5431
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ATA-APrEST95451.100
Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to...
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ATA-HPA077218.100
Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to...
| Schlagworte: | Anti-LY6H, Anti-Ly-6H, Anti-Lymphocyte antigen 6H |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: G-RPES3803.10
Human LY6H Recombinant Protein (RPES3803) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May...
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
248,00 €
Artikelnummer: CSB-CL013249HU.10
Length: 423 Sequence: atgctgcctg cagccatgaa gggcctcggc ctggcgctgc tggccgtcct gctgtgctcg gcgcccgctc atggcctgtg gtgccaggac tgcaccctga ccaccaactc cagccattgc accccaaagc agtgccagcc gtccgacacc gtgtgtgcca gtgtccgaat caccgatccc agcagcagca ggaaggatca ctcggtgaac aagatgtgtg cctcctcctg cgacttcgtt aagcgacact ttttctcaga...
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €