Zu "O94772" wurden 9 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-LY6H
Artikelnummer: G-PACO28062.50
LY6H Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. LY6H Antibody is a high quality polyclonal antibody for research use only.. Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In...
| Schlagworte: | Anti-LY6H, Anti-Ly-6H, Anti-Lymphocyte antigen 6H |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
363,00 €
LY6H, Human lymphocyte antigen 6 complex, locus H, Real...
Artikelnummer: VHPS-5431
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Anwendung: | RNA quantification |
43,00 €
Anti-LY-6H (Lymphocyte antigen 6H, LY6H)
Artikelnummer: L7715-38A.100
The LY6 antigens are a family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY-6H belongs to the LY6 family and it encodes a 140 amino acid polypeptide that is 23-33% identical to other known family members. LY-6H is higly expressed in the brain (cerebral cortex, amygdala, hippocampus and...
| Schlagworte: | Anti-Ly-6H |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
675,00 €
Recombinant Human Lymphocyte Antigen 6H/LY6H (C-6His)
Artikelnummer: ABE-32-7787-10
Source: Human Cells. MW :10.9kD. Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus. Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored...
ab 546,00 €
LY6H, Recombinant, Human, aa26-115, His-Tag (Lymphocyte...
Artikelnummer: 374099.100
Source:, Recombinant protein corresponding to aa26-115 from human Lymphocyte Antigen 6H, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.9kD, AA Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG, Storage and Stability: May be stored at 4°C...
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| MW: | 11,9 |
ab 621,00 €
LY6H PrEST Antigen
Artikelnummer: ATA-APrEST95451.100
Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to...
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €
Anti-LY6H
Artikelnummer: ATA-HPA077218.100
Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to...
| Schlagworte: | Anti-LY6H, Anti-Ly-6H, Anti-Lymphocyte antigen 6H |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
Recombinant Human LY6H Protein (His Tag) (RPES3803)
Artikelnummer: G-RPES3803.10
Human LY6H Recombinant Protein (RPES3803) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4- containing nAChRs maximum response. May...
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
299,00 €
Lymphocyte Antigen 6H/LY6H Protein(C-6His) (recombinant...
Artikelnummer: E-PKSH032715.10
Protein Construction: Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus. Sequence: Leu26-Gly115. Fusion tag: C-6His Endotoxin: < 1.0 EU per µg as determined by the LAL method. Apparent...
| Schlagworte: | LY6H, Ly-6H, Lymphocyte antigen 6H, Recombinant Human Lymphocyte Antigen 6H/LY6H Protein(C-6His) |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 10.9 kD |
ab 212,00 €