Zu "O75973" wurden 8 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-C1QL1
Anti-C1QL1

Artikelnummer: ATA-HPA071349.100

Polyclonal Antibody against Human C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Validated applications: ICC, Uniprot ID: O75973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May regulate the number...
Schlagworte: Anti-C1QRF, Anti-C1QL1, Anti-C1q-related factor, Anti-C1q/TNF-related protein 14, Anti-Complement component 1 Q...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
NEU
Anti-C1QL1
Anti-C1QL1

Artikelnummer: ATA-HPA071349.25

Polyclonal Antibody against Human C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Validated applications: ICC, Uniprot ID: O75973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May regulate the number...
Schlagworte: Anti-C1QRF, Anti-C1QL1, Anti-C1q-related factor, Anti-C1q/TNF-related protein 14, Anti-Complement component 1 Q...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
Human C1qL1 (Complement Component 1, Q Subcomponent Like Protein 1) ELISA Kit
Human C1qL1 (Complement Component 1, Q Subcomponent Like...

Artikelnummer: G-AEKE04566.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human C1qL1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human C1qL1. Next,...
Schlagworte: C1QL1, C1q-related factor, Complement component 1 Q subcomponent-like 1, C1q and tumor necrosis factor-related protein 14
Anwendung: ELISA
Spezies-Reaktivität: rat
694,00 €
Bewerten
Human C1qL1(Complement Component 1, Q Subcomponent Like Protein 1) ELISA Kit
Human C1qL1(Complement Component 1, Q Subcomponent Like...

Artikelnummer: ELK-ELK10555.48

May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity) Assay Type: Sandwich. Sensitivity: 1.29 ng/mL. Standard: 200 ng/mL. Detection range: 3.13-200 ng/mL. Sample type: Serum, plasma and other biological fluids.. Assay length: 3.5h....
Schlagworte: C1QL1, C1q-related factor, Complement component 1 Q subcomponent-like 1, C1q and tumor necrosis factor-related protein 14
Anwendung: ELISA
Spezies-Reaktivität: human
ab 374,00 €
Bewerten
C1QL1 (human), recombinant protein
C1QL1 (human), recombinant protein

Artikelnummer: ABS-PP-25878-L.100

Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. [The UniProt Consortium]
Schlagworte: C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor...
Exprimiert in: E.coli
Ursprungsart: human
MW: 26 kD
ab 115,00 €
Bewerten
C1QL1 (human), recombinant protein
C1QL1 (human), recombinant protein

Artikelnummer: ABS-PP-25878.100

Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. [The UniProt Consortium]
Schlagworte: C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor...
Exprimiert in: E.coli
Ursprungsart: human
MW: 26 kD
ab 90,00 €
Bewerten
Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) BioAssay(TM) ELISA Kit (Human)
Complement Component 1, Q Subcomponent Like Protein 1...

Artikelnummer: 024337.96

Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) BioAssay(TM) ELISA Kit (Human) is a sandwich enzyme immunoassay for the in vitro quantitative measurement of C1QL1 in human serum, plasma and other biological fluids. Detection Range: 0.156-10ng/ml, Sensitivity: 0.053ng/ml, Storage and Stability:...
Schlagworte: C1QL1, C1QRF, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor...
Anwendung: ELISA
Spezies-Reaktivität: human
1.128,00 €
Bewerten
C1QL1 PrEST Antigen
C1QL1 PrEST Antigen

Artikelnummer: ATA-APrEST95738.100

PrEST Antigen C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Antigen sequence: YHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May regulate the number of excitatory synapses...
Schlagworte: C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor...
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten