Zu "O75747" wurden 10 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-PIK3C2G
Artikelnummer: G-PACO07210.50
PIK3C2G Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. PIK3C2G Antibody is a high quality polyclonal antibody for research use only.. Protein function: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol...
| Schlagworte: | Anti-PIK3C2G, EC=2.7.1.154, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
225,00 €
Anti-PIK3C2G
Artikelnummer: CSB-PA782930.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-PIK3C2G, EC=2.7.1.154, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 126,00 €
Anti-PIK3C2G
Artikelnummer: ATA-HPA077589.100
Polyclonal Antibody against Human PIK3C2G, Gene description: phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma, Validated applications: ICC, Uniprot ID: O75747, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Generates...
| Schlagworte: | Anti-PIK3C2G, EC=2.7.1.154, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-PIK3C2G (Phosphatidylinositol 4-phosphate 3-Kinase...
Artikelnummer: 225040.100
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 834,00 €
PIK3C2G (human), recombinant protein
Artikelnummer: ABS-PP-5858-L.100
Protein function: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) that act as second messengers. May play a role in SDF1A-stimulated chemotaxis. [The UniProt Consortium]
| Schlagworte: | Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 11.5 kD |
ab 115,00 €
PIK3C2G, Human phosphoinositide-3-kinase, class 2, gamma...
Artikelnummer: VHPS-6888
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | PIK3C2G, EC=2.7.1.154, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma, Phosphoinositide 3-kinase-C2-gamma,... |
| Anwendung: | RNA quantification |
45,00 €
Anti-PI3KC2G, NT (Phosphatidylinositol-4-phosphate...
Artikelnummer: P4186-23F.200
PI3KC2G belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2...
| Schlagworte: | EC=2.7.1.154, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing... |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Anti-PI 3-Kinase C2gamma
Artikelnummer: ELK-ES8365.100
The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain...
| Schlagworte: | Anti-PIK3C2G, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide 3-kinase-C2-gamma,... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
PIK3C2G (human), recombinant protein
Artikelnummer: ABS-PP-5858.100
Protein function: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) that act as second messengers. May play a role in SDF1A-stimulated chemotaxis. [The UniProt Consortium]
| Schlagworte: | Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 11.5 kD |
ab 90,00 €
PIK3C2G PrEST Antigen
Artikelnummer: ATA-APrEST95607.100
PrEST Antigen PIK3C2G, Gene description: phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma, Antigen sequence: PNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | PIK3C2G, EC=2.7.1.154, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma, Phosphoinositide 3-kinase-C2-gamma,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €