- Suchergebnis für O70417
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "O70417" wurden 3 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ELK-ELK7995.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat PIP. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat PIP. Next, Avidin...
Schlagworte: | Pip, Prolactin-induced protein, Prolactin-inducible protein homolog |
Anwendung: | ELISA |
Spezies-Reaktivität: | rat |
ab 365,00 €
Artikelnummer: VRPS-4531
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | Pip, Prolactin-induced protein, Prolactin-inducible protein homolog |
Anwendung: | RNA quantification |
52,00 €
Artikelnummer: 374868.100
Source:, Recombinant protein corresponding to aa27-146 from rat Prolactin-inducible Protein Homolog, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.7kD, AA Sequence: QDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN,...
Schlagworte: | Pip, Prolactin-induced protein, Prolactin-inducible protein homolog |
MW: | 15,7 |
ab 497,00 €