Zu "O70417" wurden 3 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Rat PIP (Prolactin Induced Protein) ELISA Kit
Artikelnummer: ELK-ELK7995.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat PIP. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat PIP. Next, Avidin...
| Schlagworte: | Pip, Prolactin-induced protein, Prolactin-inducible protein homolog |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 365,00 €
Pip, Rat prolactin induced protein, Real Time PCR Primer Set
Artikelnummer: VRPS-4531
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Pip, Prolactin-induced protein, Prolactin-inducible protein homolog |
| Anwendung: | RNA quantification |
52,00 €
Prolactin-inducible Protein Homolog, Recombinant, Rat,...
Artikelnummer: 374868.100
Source:, Recombinant protein corresponding to aa27-146 from rat Prolactin-inducible Protein Homolog, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.7kD, AA Sequence: QDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN,...
| Schlagworte: | Pip, Prolactin-induced protein, Prolactin-inducible protein homolog |
| MW: | 15,7 |
ab 497,00 €
