Zu "O60931" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-CTNS
Artikelnummer: ATA-HPA046947.100
Protein function: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is...
| Schlagworte: | Anti-CTNS, Anti-Cystinosin |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-CTNS
Artikelnummer: ATA-HPA074687.100
Polyclonal Antibody against Human CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Validated applications: ICC, Uniprot ID: O60931, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-CTNS, Anti-Cystinosin |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
CTNS, Human cystinosis, nephropathic, Real Time PCR...
Artikelnummer: VHPS-2317
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | CTNS, Cystinosin |
| Anwendung: | RNA quantification |
45,00 €
CTNS PrEST Antigen
Artikelnummer: ATA-APrEST91085.100
Protein function: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | CTNS, Cystinosin |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-CTNS
Artikelnummer: ELK-ES17182.100
This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript...
| Schlagworte: | Anti-Cystinosin, CTNS rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
CTNS (Vector pENTR223.1, Accession No. BC032850)
Artikelnummer: CSB-CL006174HU.10
Length: 1203 Sequence: atgataagga attggctgac tatttttatc ctttttcccc tgaagctcgt agagaaatgt gagtcaagcg tcagcctcac tgttcctcct gtcgtaaagc tggagaacgg cagctcgacc aacgtcagcc tcaccctgcg gccaccatta aatgcaaccc tggtgatcac ttttgaaatc acatttcgtt ccaaaaatat tactatcctt gagctccccg atgaagttgt ggtgcctcct ggagtgacaa actcctcttt...
| Schlagworte: | CTNS, Cystinosin |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Anti-CTNS
Artikelnummer: CSB-PA006174GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: CTNS. Antigen Species: Human
| Schlagworte: | Anti-CTNS, Anti-Cystinosin, ctns antibody, CTNS LSB antibody, CTNS_HUMAN antibody, Cystinosin antibody, Cystinosin,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
CTNS PrEST Antigen
Artikelnummer: ATA-APrEST96215.100
PrEST Antigen CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Antigen sequence: PDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Cystine/H(+) symporter...
| Schlagworte: | CTNS, Cystinosin |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €