Zu "O43150" wurden 10 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ASAP2
Artikelnummer: A303-311A
Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
| Schlagworte: | Anti-PAP, Anti-PAG3, Anti-ASAP2, Anti-DDEF2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and... |
| Anwendung: | WB, IP |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 165,00 €
Anti-ASAP2
Artikelnummer: ATA-HPA068383.100
Polyclonal Antibody against Human ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Validated applications: ICC, Uniprot ID: O43150, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
| Schlagworte: | Anti-PAP, Anti-PAG3, Anti-DDEF2, Anti-ASAP2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
ASAP2 (human), recombinant protein
Artikelnummer: ABS-PP-4632-L.100
Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
| Schlagworte: | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2, Development and differentiation-enhancing factor... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 46.5 kD |
ab 115,00 €
DDEF2, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-2497
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | PAP, PAG3, DDEF2, ASAP2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,... |
| Anwendung: | RNA quantification |
45,00 €
Anti-ASAP2 (Arf-GAP with SH3 Domain, ANK Repeat and PH...
Artikelnummer: A3334-96.100
ASAP2 is a multidomain protein belonging to the beta family with two ANK repeats, an Arf-GAP domain, a PH domain and a SH3 domain. This protein localizes in the Golgi apparatus and also at the plasma membrane where it colocalizes with protein tyrosine kinase 2-beta (PYK2) and forms a stable complex with PYK2 in...
| Schlagworte: | Anti-Pyk2 C-terminus-associated protein, Anti-Development and differentiation-enhancing factor 2, Anti-Paxillin-associated... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
667,00 €
Anti-ASAP2
Artikelnummer: G-CAB17579.20
Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
| Schlagworte: | Anti-PAP, Anti-PAG3, Anti-DDEF2, Anti-ASAP2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
149,00 €
Anti-ASAP2
Artikelnummer: ELK-ES8991.100
This gene encodes a multidomain protein containing an N-terminal alpha-helical region with a coiled-coil motif, followed by a pleckstrin homology (PH) domain, an Arf-GAP domain, an ankyrin homology region, a proline-rich region, and a C-terminal Src homology 3 (SH3) domain. The protein localizes in the Golgi...
| Schlagworte: | Anti-PAP, Anti-PAG3, Anti-DDEF2, Anti-ASAP2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
ASAP2 (Vector pUC, Accession No. BC063308)
Artikelnummer: CSB-CL002176HU.10
Length: 2886 Sequence: atgccggacc agatctccgt gtcggaattc gtggccgaga cccatgagga ctacaaggcg cccacggcct ccagcttcac cacccgcacg gcgcagtgcc ggaacactgt ggcggccatc gaggaggctt tggacgtgga ccggatggtt ctttacaaaa tgaagaaatc cgtgaaagca atcaacagct ctgggctggc tcacgtggaa aatgaagagc agtacaccca ggctctggag aagtttggcg gcaaccgtgt...
| Schlagworte: | PAP, PAG3, ASAP2, DDEF2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
1.044,00 €
ASAP2 (human), recombinant protein
Artikelnummer: ABS-PP-4632.100
Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
| Schlagworte: | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2, Development and differentiation-enhancing factor... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 46.5 kD |
ab 90,00 €
ASAP2 PrEST Antigen
Artikelnummer: ATA-APrEST95867.100
PrEST Antigen ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Antigen sequence: WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Schlagworte: | PAP, PAG3, ASAP2, DDEF2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €