Zu "K24488" wurden 7 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-FNDC8
Anti-FNDC8

Artikelnummer: ATA-HPA026521.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 53% and to rat: 52%
Schlagworte: Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8
Anwendung: IHC, WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Anti-FNDC8
Anti-FNDC8

Artikelnummer: ATA-HPA059803.100

Polyclonal Antibody against Human FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Validated applications: ICC, Uniprot ID: Q8TC99, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
Schlagworte: Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
FNDC8 (human), recombinant protein
FNDC8 (human), recombinant protein

Artikelnummer: ABS-PP-9760-L.100

Schlagworte: Fibronectin type III domain-containing protein 8, Recombinant Human FNDC8 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 18.5 kD
ab 115,00 €
Bewerten
Anti-FNDC8, ID (FNDC8, Fibronectin type III domain-containing protein 8)
Anti-FNDC8, ID (FNDC8, Fibronectin type III...

Artikelnummer: 035704.200

Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...
Schlagworte: Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
FNDC8 PrEST Antigen
FNDC8 PrEST Antigen

Artikelnummer: ATA-APrEST75528.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: FNDC8, Fibronectin type III domain-containing protein 8
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
FNDC8 (human), recombinant protein
FNDC8 (human), recombinant protein

Artikelnummer: ABS-PP-9760.100

Schlagworte: Fibronectin type III domain-containing protein 8, Recombinant Human FNDC8 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 18.5 kD
ab 90,00 €
Bewerten
FNDC8 PrEST Antigen
FNDC8 PrEST Antigen

Artikelnummer: ATA-APrEST96089.100

PrEST Antigen FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Antigen sequence: EVAKTQENELPEAKNRPWIFNKILGTTVKLMELKPNTCYCLSVRAANTAGVGKWCKPYKFATLATDFSSFPENYPIQITVRRKEPRQKIVSIGPEEMRRLEDLEYLFPC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Schlagworte: FNDC8, Fibronectin type III domain-containing protein 8
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten