- Suchergebnis für K24134
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K24134" wurden 10 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA044426.100
Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
| Schlagworte: | Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,... |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 330,00 €
Artikelnummer: ATA-HPA076940.100
Polyclonal Antibody against Human ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Validated applications: ICC, Uniprot ID: Q96AP4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA076940.25
Polyclonal Antibody against Human ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Validated applications: ICC, Uniprot ID: Q96AP4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: 044425.200
Applications:, Suitable for use in Western Blot and ELISA. Other applications have not been tested. , Recommended Dilution: Western Blot: 1:1000, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing....
| Schlagworte: | Anti-ZUFSP, Anti-C6orf113, Anti-Zinc finger with UFM1-specific peptidase domain protein |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | hamster, human, mouse |
865,00 €
Artikelnummer: ATA-APrEST70192.100
Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
| Schlagworte: | DUB, C6orf113, Lys-63-specific deubiquitinase ZUFSP, Zinc finger-containing ubiquitin peptidase 1, Zinc finger with... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES12066.100
Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
| Schlagworte: | Anti-DUB, Anti-C6orf113, Anti-Lys-63-specific deubiquitinase ZUFSP, Anti-Zinc finger-containing ubiquitin peptidase 1,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
Artikelnummer: CSB-CL853384HU.10
Length: 1737 Sequence: atgctttcct gtaatatttg tggtgaaaca gtaacctcag aaccagacat gaaagctcac ctaattgttc acatggaaag tgaaattata tgtccatttt gcaagttgtc aggtgtgaat tatgatgaaa tgtgttttca tatcgaaaca gctcattttg agcagaatac acttgaaaga aactttgaga ggataaatac agtacaatat ggaacttcag ataacaagaa agacaacacc ctacagtgtg gaatggaagt...
| Schlagworte: | DUB, C6orf113, Lys-63-specific deubiquitinase ZUFSP, Zinc finger-containing ubiquitin peptidase 1, Zinc finger with... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
357,00 €
Artikelnummer: ABS-PP-9546.100
Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
| Schlagworte: | Zinc finger-containing ubiquitin peptidase 1, Lys-63-specific deubiquitinase ZUFSP, DUB, Zinc finger with UFM1-specific... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 31 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95798.100
PrEST Antigen ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Antigen sequence: TSKPPIYLQHQGHSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLEEKLARRQASQVFTA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Schlagworte: | DUB, C6orf113, Lys-63-specific deubiquitinase ZUFSP, Zinc finger-containing ubiquitin peptidase 1, Zinc finger with... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-9546-L.100
Protein function: Deubiquitinase with endodeubiquitinase activity that specifically interacts with and cleaves 'Lys-63'-linked long polyubiquitin chains. Shows only weak activity against 'Lys-11' and 'Lys-48'-linked chains (PubMed:29576528, PubMed:29563501, PubMed:29476094). Plays an important role in genome...
| Schlagworte: | Zinc finger-containing ubiquitin peptidase 1, Lys-63-specific deubiquitinase ZUFSP, DUB, Zinc finger with UFM1-specific... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 31 kD |
ab 115,00 €