- Suchergebnis für K23880
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K23880" wurden 24 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: CSB-CF691821RA.100
Organism: Rattus norvegicus (Rat). Source: in vitro E.coli expression system. Expression Region: 1-480aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: MASPAPEEHA TQGCPATEEQ EPRPGVPGEE AGPEGAGPQV EEAAGRVAAA LTWLLGEPVL WLGWRADELL SWKRPLRSLL AFLGANLLFW FLALTPWRVY HLISVMILGR...
Schlagworte: | Fam134b, Reticulophagy receptor 1, Reticulophagy regulator 1 |
Anwendung: | Activity not tested |
Exprimiert in: | E.coli in vitro |
Ursprungsart: | rat |
MW: | 58.8 kD |
ab 1.458,00 €
Artikelnummer: ATA-HPA075910.100
Polyclonal Antibody against Human RETREG2, Gene description: reticulophagy regulator family member 2, Alternative Gene Names: C2orf17, FAM134A, MAG-2, MGC3035, Validated applications: IHC, Uniprot ID: Q8NC44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene...
Schlagworte: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: A305-800A-T
Schlagworte: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
Anwendung: | IP |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 178,00 €
Artikelnummer: A304-684A
Protein function: Mediates NRF1-enhanced neurite outgrowth. [The UniProt Consortium]
Schlagworte: | Anti-FAM134C, Anti-Protein FAM134C |
Anwendung: | WB, IP |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 178,00 €
Artikelnummer: A305-801A
Schlagworte: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
Anwendung: | WB, IP |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 178,00 €
Artikelnummer: E-AB-18973.120
The protein encoded by this gene is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Mutations in this gene are a cause of hereditary sensory and autonomic neuropathy type IIB (HSAN IIB), and this gene may also play a role in...
Schlagworte: | Anti-FAM134B, Anti-Reticulophagy receptor 1, Anti-Reticulophagy regulator 1, RETREG1 Polyclonal Antibody |
Anwendung: | WB, IHC, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 89,00 €
Artikelnummer: E-AB-52883.120
The protein encoded by this gene is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Mutations in this gene are a cause of hereditary sensory and autonomic neuropathy type IIB (HSAN IIB), and this gene may also play a role in...
Schlagworte: | Anti-FAM134B, Anti-Reticulophagy receptor 1, Anti-Reticulophagy regulator 1, RETREG1 Polyclonal Antibody |
Anwendung: | WB, IHC, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 89,00 €
Artikelnummer: G-PACO49302.50
FAM134B Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. FAM134B Antibody is a high quality polyclonal antibody for research use only.. Protein function: Endoplasmic reticulum-anchored autophagy receptor that mediates ER delivery into...
Schlagworte: | Anti-FAM134B, Anti-Reticulophagy receptor 1, Anti-Reticulophagy regulator 1 |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
384,00 €
Artikelnummer: ATA-HPA011170.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 77% and to rat: 80%
Schlagworte: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 320,00 €
Artikelnummer: ATA-HPA016492.100
Protein function: Mediates NRF1-enhanced neurite outgrowth. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 86% and to rat: 85%
Schlagworte: | Anti-FAM134C, Anti-Reticulophagy regulator 3 |
Anwendung: | IHC, WB, ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
450,00 €
Artikelnummer: ATA-HPA012077.100
Protein function: Endoplasmic reticulum-anchored autophagy receptor that mediates ER delivery into lysosomes through sequestration into autophagosomes (PubMed:26040720). Promotes membrane remodeling and ER scission via its membrane bending capacity and targets the fragments into autophagosomes via interaction with...
Schlagworte: | Anti-FAM134B, Anti-Reticulophagy receptor 1, Anti-Reticulophagy regulator 1 |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 320,00 €

Artikelnummer: ATA-APrEST95680.100
PrEST Antigen RETREG2, Gene description: reticulophagy regulator family member 2, Alternative Gene Names: C2orf17, FAM134A, MAG-2, MGC3035, Antigen sequence: LIQRMYTRLEPLLMQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETES, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 94% Rat...
Schlagworte: | C2orf17, Reticulophagy regulator 2 |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €