Zu "K19373" wurden 9 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-DNAJC28
Anti-DNAJC28

Artikelnummer: ATA-HPA018003.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 87%
Schlagworte: Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
Anti-DNAJC28
Anti-DNAJC28

Artikelnummer: ATA-HPA030076.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 62%
Schlagworte: Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
Anti-DNAJC28
Anti-DNAJC28

Artikelnummer: ATA-HPA077153.100

Polyclonal Antibody against Human DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Validated applications: ICC, Uniprot ID: Q9NX36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
Schlagworte: Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
DNAJC28 (human), recombinant protein
DNAJC28 (human), recombinant protein

Artikelnummer: ABS-PP-6754-L.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium]
Schlagworte: DnaJ homolog subfamily C member 28, Recombinant Human DNAJC28 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 18.5 kD
ab 115,00 €
Bewerten
Anti-DNAJC28, CT (DNAJC28, C21orf55, C21orf78, DnaJ homolog subfamily C member 28)
Anti-DNAJC28, CT (DNAJC28, C21orf55, C21orf78, DnaJ...

Artikelnummer: 034719.200

DNAJC28 may have a role in protein folding or as a chaperone. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots...
Schlagworte: Anti-DNAJC28, Anti-C21orf55, Anti-DnaJ homolog subfamily C member 28
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
DNAJC28 PrEST Antigen
DNAJC28 PrEST Antigen

Artikelnummer: ATA-APrEST73895.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: DNAJC28, C21orf55, DnaJ homolog subfamily C member 28
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
DNAJC28 PrEST Antigen
DNAJC28 PrEST Antigen

Artikelnummer: ATA-APrEST78840.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: DNAJC28, C21orf55, DnaJ homolog subfamily C member 28
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
DNAJC28 (human), recombinant protein
DNAJC28 (human), recombinant protein

Artikelnummer: ABS-PP-6754.100

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium]
Schlagworte: DnaJ homolog subfamily C member 28, Recombinant Human DNAJC28 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 18.5 kD
ab 90,00 €
Bewerten
DNAJC28 PrEST Antigen
DNAJC28 PrEST Antigen

Artikelnummer: ATA-APrEST96141.100

PrEST Antigen DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Antigen sequence: VLSHVIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFPDSVIVKNIRQSKQQKITQAI, Storage: Upon delivery store at -20°C. Avoid repeated...
Schlagworte: DNAJC28, C21orf55, DnaJ homolog subfamily C member 28
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten