- Suchergebnis für K18762
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K18762" wurden 13 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA041319.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 35% and to rat: 30%
| Schlagworte: | Anti-ZAR1L, Anti-ZAR1-like protein |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: CSB-PA004554.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-ZAR1, Anti-Zygote arrest protein 1, Anti-Oocyte-specific maternal effect factor, Oocyte-specific maternal effect... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
126,00 €
Artikelnummer: CSB-PA186654.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-ZAR1, Anti-Zygote arrest protein 1, Anti-Oocyte-specific maternal effect factor, Oocyte-specific maternal effect... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
284,00 €
Artikelnummer: ATA-HPA039540.100
Polyclonal Antibody against Human ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Validated applications: ICC, Uniprot ID: A6NP61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 44% Rat gene identity: 44%
| Schlagworte: | Anti-ZAR1L, Anti-ZAR1-like protein |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA039540.25
Polyclonal Antibody against Human ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Validated applications: ICC, Uniprot ID: A6NP61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 44% Rat gene identity: 44%
| Schlagworte: | Anti-ZAR1L, Anti-ZAR1-like protein |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: 043986.200
The female gamete, the oocyte, serves the distinct purpose of transmitting the maternal genome and other maternal factors critical for postovulation events. Oocytes have diverse functions in ovarian folliculogenesis, fertilization, and embryogenesis. ZAR1 is an oocyte-specific gene that appears to function at the...
| Schlagworte: | Anti-ZAR1, Anti-Zygote arrest protein 1, Anti-Oocyte-specific maternal effect factor |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ATA-APrEST81392.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ZAR1L, ZAR1-like protein |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES3723.100
This maternal effect gene is oocyte-specific and encodes a protein that is thought to function in the initiation of embryogenesis. A similar protein in mouse is required for female fertility. [provided by RefSeq, Jul 2013], Protein function: mRNA-binding protein that mediates formation of MARDO...
| Schlagworte: | Anti-Zygote arrest protein 1, ZAR1 rabbit pAb |
| Anwendung: | WB, IHC, IF, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Artikelnummer: ABS-PP-6546.100
Protein function: Essential for female fertility. May play a role in the oocyte-to-embryo transition. [The UniProt Consortium]
| Schlagworte: | Zygote arrest protein 1, Recombinant Human ZAR1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 12 kD |
ab 90,00 €
Artikelnummer: ABS-PP-9500.100
| Schlagworte: | Protein ZAR1-like, Zygote arrest protein 1-like, Recombinant Human ZAR1L Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 16 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95928.100
PrEST Antigen ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Antigen sequence: FVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCIDPYKRAQLKAILSQMNPSLSPRLCKPNTK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 44% Rat gene identity:...
| Schlagworte: | ZAR1L, ZAR1-like protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-6546-L.100
Protein function: Essential for female fertility. May play a role in the oocyte-to-embryo transition. [The UniProt Consortium]
| Schlagworte: | Zygote arrest protein 1, Recombinant Human ZAR1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 12 kD |
ab 115,00 €