Zu "K18762" wurden 13 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZAR1L
Anti-ZAR1L

Artikelnummer: ATA-HPA041319.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 35% and to rat: 30%
Schlagworte: Anti-ZAR1L, Anti-ZAR1-like protein
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Anti-ZAR1
Anti-ZAR1

Artikelnummer: CSB-PA004554.50

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Schlagworte: Anti-ZAR1, Anti-Zygote arrest protein 1, Anti-Oocyte-specific maternal effect factor, Oocyte-specific maternal effect...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
126,00 €
Bewerten
Anti-ZAR1
Anti-ZAR1

Artikelnummer: CSB-PA186654.100

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Schlagworte: Anti-ZAR1, Anti-Zygote arrest protein 1, Anti-Oocyte-specific maternal effect factor, Oocyte-specific maternal effect...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
284,00 €
Bewerten
Anti-ZAR1L
Anti-ZAR1L

Artikelnummer: ATA-HPA039540.100

Polyclonal Antibody against Human ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Validated applications: ICC, Uniprot ID: A6NP61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 44% Rat gene identity: 44%
Schlagworte: Anti-ZAR1L, Anti-ZAR1-like protein
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-ZAR1L
Anti-ZAR1L

Artikelnummer: ATA-HPA039540.25

Polyclonal Antibody against Human ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Validated applications: ICC, Uniprot ID: A6NP61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 44% Rat gene identity: 44%
Schlagworte: Anti-ZAR1L, Anti-ZAR1-like protein
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
Anti-ZAR1, ID (ZAR1, Zygote arrest protein 1, Oocyte-specific maternal effect factor)
Anti-ZAR1, ID (ZAR1, Zygote arrest protein 1,...

Artikelnummer: 043986.200

The female gamete, the oocyte, serves the distinct purpose of transmitting the maternal genome and other maternal factors critical for postovulation events. Oocytes have diverse functions in ovarian folliculogenesis, fertilization, and embryogenesis. ZAR1 is an oocyte-specific gene that appears to function at the...
Schlagworte: Anti-ZAR1, Anti-Zygote arrest protein 1, Anti-Oocyte-specific maternal effect factor
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
ZAR1L PrEST Antigen
ZAR1L PrEST Antigen

Artikelnummer: ATA-APrEST81392.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: ZAR1L, ZAR1-like protein
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-ZAR1
Anti-ZAR1

Artikelnummer: ELK-ES3723.100

This maternal effect gene is oocyte-specific and encodes a protein that is thought to function in the initiation of embryogenesis. A similar protein in mouse is required for female fertility. [provided by RefSeq, Jul 2013], Protein function: mRNA-binding protein that mediates formation of MARDO...
Schlagworte: Anti-Zygote arrest protein 1, ZAR1 rabbit pAb
Anwendung: WB, IHC, IF, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, rat, mouse,
ab 173,00 €
Bewerten
ZAR1 (human), recombinant protein
ZAR1 (human), recombinant protein

Artikelnummer: ABS-PP-6546.100

Protein function: Essential for female fertility. May play a role in the oocyte-to-embryo transition. [The UniProt Consortium]
Schlagworte: Zygote arrest protein 1, Recombinant Human ZAR1 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 12 kD
ab 90,00 €
Bewerten
ZAR1L (human), recombinant protein
ZAR1L (human), recombinant protein

Artikelnummer: ABS-PP-9500.100

Schlagworte: Protein ZAR1-like, Zygote arrest protein 1-like, Recombinant Human ZAR1L Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 16 kD
ab 90,00 €
Bewerten
ZAR1L PrEST Antigen
ZAR1L PrEST Antigen

Artikelnummer: ATA-APrEST95928.100

PrEST Antigen ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Antigen sequence: FVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCIDPYKRAQLKAILSQMNPSLSPRLCKPNTK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 44% Rat gene identity:...
Schlagworte: ZAR1L, ZAR1-like protein
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
ZAR1 (human), recombinant protein
ZAR1 (human), recombinant protein

Artikelnummer: ABS-PP-6546-L.100

Protein function: Essential for female fertility. May play a role in the oocyte-to-embryo transition. [The UniProt Consortium]
Schlagworte: Zygote arrest protein 1, Recombinant Human ZAR1 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 12 kD
ab 115,00 €
Bewerten
1 von 2 Seiten