Zu "K17436" wurden 13 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPL55
Artikelnummer: ATA-HPA027641.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 79% and to rat: 78%
| Schlagworte: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
39S ribosomal protein L55, mitochondrial (MRPL55), human,...
Artikelnummer: CSB-EP014872HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 34-128aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: DSSRASLTRV HRQAYARLYP VLLVKQDGST IHIRYREPRR MLAMPIDLDT LSPEERRARL RKREAQLQSR KEYEQELSDD LHVERYRQFW TRTKK. Purity: Greater than 90% as...
| Schlagworte: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 38.6 kD |
ab 219,00 €
MRPL55, Recombinant, Human, aa34-128, GST-Tag (39S...
Artikelnummer: 374273.1
Source:, Recombinant protein corresponding to aa34-128 from human MRPL55, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD, AA Sequence: DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK, Storage and Stability: May be stored at 4°C for...
| Schlagworte: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| MW: | 38,6 |
ab 603,00 €
MRPL55 PrEST Antigen
Artikelnummer: ATA-APrEST77022.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-MRPL55
Artikelnummer: G-CAB18242.20
MRPL55 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human and for use in WB applications.MRPL55 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Schlagworte: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
103,00 €
Anti-Mrpl55
Artikelnummer: G-CAB18244.20
Mrpl55 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human, Mouse and for use in WB applications.Mrpl55 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Schlagworte: | Anti-L55mt, Anti-Mrpl55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
103,00 €
Anti-RM55
Artikelnummer: ELK-ES9307.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Schlagworte: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-Large ribosomal subunit protein mL55, Anti-39S ribosomal protein L55,... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
MRPL55 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL768781HU.10
Length: 387 Sequence: atggcggccg tgggcagcct gcttggccgg ctgaggcaga gcaccgtgaa ggccaccgga cctgcactcc gccgcctgca cacatcctcc tggcgagctg acagcagcag ggcctcactc actcgtgtgc accgccaggc ttatgcacga ctctaccccg tgctgctggt gaagcaggat ggctccacca tccacatccg ctacagggag ccacggcgca tgctggcgat gcccatagat ctggacaccc tgtctcctga...
| Schlagworte: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Anti-MRPL55
Artikelnummer: CSB-PA014872EA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Schlagworte: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-MRPL55, FITC conjugated
Artikelnummer: CSB-PA014872EC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Schlagworte: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-MRPL55, HRP conjugated
Artikelnummer: CSB-PA014872EB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Schlagworte: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-MRPL55, Biotin conjugated
Artikelnummer: CSB-PA014872ED01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Schlagworte: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €