- Suchergebnis für K16767
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K16767" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG55071.100
| Schlagworte: | Anti-CEP112, Anti-Cep112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
616,00 €
Artikelnummer: ATA-HPA024481.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 82% and to rat: 77%
| Schlagworte: | Anti-Cep112, Anti-CEP112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA069724.100
Polyclonal Antibody against Human CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Validated applications: ICC, Uniprot ID: Q8N8E3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 100% Rat gene identity: 100%
| Schlagworte: | Anti-CCDC46, Anti-CEP112, Anti-Cep112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-8008-L.100
| Schlagworte: | Centrosomal protein of 112 kDa, Cep112, Coiled-coil domain-containing protein 46, Recombinant Human CEP112 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15 kD |
ab 115,00 €
Artikelnummer: 033326.200
CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of this gene exist in mouse, rat and chimp. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000,...
| Schlagworte: | Anti-CCDC46, Anti-CEP112, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ATA-APrEST75738.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | Cep112, CEP112, CCDC46, Centrosomal protein of 112 kDa, Coiled-coil domain-containing protein 46 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES17530.100
This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate...
| Schlagworte: | Anti-Cep112, Anti-CEP112, Anti-CCDC46, Anti-Centrosomal protein of 112 kDa, Anti-Coiled-coil domain-containing protein 46,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: ABS-PP-8008.100
| Schlagworte: | Centrosomal protein of 112 kDa, Cep112, Coiled-coil domain-containing protein 46, Recombinant Human CEP112 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST96046.100
PrEST Antigen CEP112, Gene description: centrosomal protein 112, Alternative Gene Names: CCDC46, MGC33887, Antigen sequence: LMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 100% Rat gene identity: 100%
| Schlagworte: | CCDC46, Cep112, CEP112, Centrosomal protein of 112 kDa, Coiled-coil domain-containing protein 46 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €