Zu "K15604" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-LYL1
Artikelnummer: ATA-HPA075004.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 82% and to rat: 82%
| Schlagworte: | Anti-LYL1, Anti-BHLHA18, Anti-bHLHa18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Anwendung: | ICC, ChIP |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-LYL1
Artikelnummer: CSB-PA284084.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-LYL1, Anti-bHLHa18, Anti-BHLHA18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
284,00 €
Anti-LYL1
Artikelnummer: ATA-HPA072177.100
Polyclonal Antibody against Human LYL1, Gene description: LYL1 basic helix-loop-helix family member, Alternative Gene Names: bHLHa18, Validated applications: ICC, Uniprot ID: P12980, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 91% Rat gene identity: 91%
| Schlagworte: | Anti-LYL1, Anti-BHLHA18, Anti-bHLHa18, Anti-Protein lyl-1, Anti-Lymphoblastic leukemia-derived sequence 1, Anti-Class A... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
LYL1 PrEST Antigen
Artikelnummer: ATA-APrEST93260.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | LYL1, BHLHA18, bHLHa18, Protein lyl-1, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-Lyl-1
Artikelnummer: ABD-8C10354.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-Lyl-1 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-LYL1, Anti-bHLHa18, Anti-BHLHA18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
628,00 €
Anti-Lyl-1
Artikelnummer: ELK-ES6144.100
This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia. [provided by...
| Schlagworte: | Anti-LYL1, Anti-BHLHA18, Anti-bHLHa18, Anti-Protein lyl-1, Anti-Lymphoblastic leukemia-derived sequence 1, Anti-Class A... |
| Anwendung: | IHC, IF, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
Anti-LYL1
Artikelnummer: CSB-PA009891.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-LYL1, Anti-bHLHa18, Anti-BHLHA18, Anti-Protein lyl-1, Anti-Class A basic helix-loop-helix protein 18,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
126,00 €
LYL1 PrEST Antigen
Artikelnummer: ATA-APrEST95852.100
PrEST Antigen LYL1, Gene description: LYL1 basic helix-loop-helix family member, Alternative Gene Names: bHLHa18, Antigen sequence: TAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 91% Rat gene identity: 91%
| Schlagworte: | LYL1, bHLHa18, BHLHA18, Protein lyl-1, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €