Zu "K15523" wurden 14 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-FN3KRP
Artikelnummer: E-AB-18182.120
A high concentration of glucose can result in non-enzymatic oxidation of proteins by reaction of glucose and lysine residues (glycation). Proteins modified in this way are less active or functional. This gene encodes an enzyme which catalyzes the phosphorylation of psicosamines and ribulosamines compared to the...
| Schlagworte: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 89,00 €
Anti-FN3KRP
Artikelnummer: ATA-HPA056172.100
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Schlagworte: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Anwendung: | ICC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-FN3KRP
Artikelnummer: ATA-HPA065831.100
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Schlagworte: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-FN3KRP
Artikelnummer: ATA-HPA065939.100
Polyclonal Antibody against Human FN3KRP, Gene description: fructosamine 3 kinase related protein, Alternative Gene Names: FLJ12171, FN3KL, Validated applications: ICC, WB, Uniprot ID: Q9HA64, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Anwendung: | WB, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
FN3KRP (human), recombinant protein
Artikelnummer: ABS-PP-8883-L.100
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Schlagworte: | Ketosamine-3-kinase, Fructosamine-3-kinase-related protein, FN3K-RP, FN3K-related protein, Protein-psicosamine 3-kinase... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 21.5 kD |
ab 115,00 €
FN3KRP, Recombinant, Human, aa1-309, His-Tag...
Artikelnummer: 349919.500
Ketosamine-3-kinase, also known as FN3KRP, catalyzes the phosphorylation of psicosamines and ribulosamines compared to the neighboring gene which encodes a highly similar enzyme, fructosamine-3-kinase, which has different substrate specificity. The activity of both enzymes may result in deglycation of proteins to...
| Schlagworte: | FN3K-RP, Ketosamine-3-kinase, FN3K-related protein, Protein-psicosamine 3-kinase FN3KRP, Fructosamine-3-kinase-related... |
| Ursprungsart: | human |
| MW: | 36.8 kD |
ab 636,00 €
FN3KRP PrEST Antigen
Artikelnummer: ATA-APrEST88161.100
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Schlagworte: | FN3K-RP, Ketosamine-3-kinase, FN3K-related protein, Protein-psicosamine 3-kinase FN3KRP, Fructosamine-3-kinase-related... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-FN3KRP
Artikelnummer: G-CAB15512.20
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Schlagworte: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
103,00 €
FN3KRP (Vector Vector will be determined during the...
Artikelnummer: CSB-CL867182HU.10
Length: 930 Sequence: atggaggagc tgctgaggcg cgagctgggc tgcagctctg tcagggccac gggccactcg gggggcgggt gcatcagcca gggccggagc tacgacacgg atcaaggacg agtgttcgtg aaagtgaacc ccaaggcgga ggccagaaga atgtttgaag gtgagatggc aagtttaact gccatcctga aaacaaacac ggtgaaagtg cccaagccca tcaaggttct ggatgcccca ggcggcggga gcgtgctggt...
| Schlagworte: | FN3K-RP, Ketosamine-3-kinase, FN3K-related protein, Protein-psicosamine 3-kinase FN3KRP, Fructosamine-3-kinase-related... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Anti-FN3KRP
Artikelnummer: CSB-PA008761GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: FN3KRP. Antigen Species: Human
| Schlagworte: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
FN3KRP (human), recombinant protein
Artikelnummer: ABS-PP-8883.100
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Schlagworte: | Ketosamine-3-kinase, Fructosamine-3-kinase-related protein, FN3K-RP, FN3K-related protein, Protein-psicosamine 3-kinase... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 21.5 kD |
ab 90,00 €
FN3KRP PrEST Antigen
Artikelnummer: ATA-APrEST95687.100
PrEST Antigen FN3KRP, Gene description: fructosamine 3 kinase related protein, Alternative Gene Names: FLJ12171, FN3KL, Antigen sequence: GRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIKVLDA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Ketosamine-3-kinase involved in protein...
| Schlagworte: | FN3K-RP, Ketosamine-3-kinase, FN3K-related protein, Protein-psicosamine 3-kinase FN3KRP, Fructosamine-3-kinase-related... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €