Zu "K14768" wurden 13 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-WDR46
Anti-WDR46

Artikelnummer: ATA-HPA043004.100

Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to...
Schlagworte: Anti-FP221, Anti-BING4, Anti-WDR46, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Anti-WDR46 / BING4
Anti-WDR46 / BING4

Artikelnummer: NSJ-RQ7402

0.5mg/ml if reconstituted with 0.2ml sterile DI water. WD repeat-containing protein 46 is a protein that in humans is encoded by the WDR46 gene. Enables RNA binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Predicted to be located...
Schlagworte: Anti-FP221, Anti-WDR46, Anti-BING4, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4, WDR46...
Anwendung: WB, FC, Direct ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
790,00 €
Bewerten
Anti-WDR46
Anti-WDR46

Artikelnummer: ATA-HPA055425.100

Polyclonal Antibody against Human WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Validated applications: ICC, Uniprot ID: O15213, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Scaffold component of the...
Schlagworte: Anti-WDR46, Anti-BING4, Anti-FP221, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-WDR46
Anti-WDR46

Artikelnummer: ATA-HPA055425.25

Polyclonal Antibody against Human WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Validated applications: ICC, Uniprot ID: O15213, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Scaffold component of the...
Schlagworte: Anti-WDR46, Anti-BING4, Anti-FP221, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
C6orf11, Human, Real Time PCR Primer Set
C6orf11, Human, Real Time PCR Primer Set

Artikelnummer: VHPS-1322

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: WDR46, BING4, FP221, WD repeat-containing protein 46, WD repeat-containing protein BING4
Anwendung: RNA quantification
45,00 €
Bewerten
WDR46 PrEST Antigen
WDR46 PrEST Antigen

Artikelnummer: ATA-APrEST82937.100

Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: FP221, BING4, WDR46, WD repeat-containing protein 46, WD repeat-containing protein BING4
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
WDR46 (Vector pUC, Accession No. BC000388)
WDR46 (Vector pUC, Accession No. BC000388)

Artikelnummer: CSB-CL026034HU.10

Length: 1833 Sequence: atggagacag cccccaagcc gggcaaggat gtcccgccca agaaagacaa acttcagacc aagagaaaga aaccgcggcg atactgggag gaagagaccg ttccgaccac agccggagcc tctccagggc ctcctcgtaa caagaagaat cgggagctcc gtcctcagag accaaaaaat gcttacatct taaagaagtc tcggatctct aagaagcctc aggtcccgaa gaaaccccga gaatggaaga acccggagtc...
Schlagworte: FP221, BING4, WDR46, WD repeat-containing protein 46, WD repeat-containing protein BING4
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
671,00 €
Bewerten
Anti-WDR46
Anti-WDR46

Artikelnummer: CSB-PA026034GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: WDR46. Antigen Species: Human
Schlagworte: Anti-BING4, Anti-FP221, Anti-WDR46, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4, WDR46...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
552,00 €
Bewerten
WDR46 (human), recombinant protein
WDR46 (human), recombinant protein

Artikelnummer: ABS-PP-691.100

Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium]
Schlagworte: WD repeat-containing protein 46, WD repeat-containing protein BING4, Recombinant Human WDR46 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 21 kD
ab 90,00 €
Bewerten
WDR46 PrEST Antigen
WDR46 PrEST Antigen

Artikelnummer: ATA-APrEST96212.100

PrEST Antigen WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Antigen sequence: LSTRTLPHGAGHLAFSQRGLLVAGMGDVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Scaffold component...
Schlagworte: WDR46, BING4, FP221, WD repeat-containing protein 46, WD repeat-containing protein BING4
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-UTP7
Anti-UTP7

Artikelnummer: CSB-PA336669XA01SVG.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-UTP7, Anti-KRE31, Anti-YER082C, Anti-U three protein 7, Anti-U3 snoRNA-associated protein 7, Anti-U3 small nucleolar...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
ab 1.529,00 €
Bewerten
Anti-utp7
Anti-utp7

Artikelnummer: CSB-PA882203XA01SXV.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-utp7, Anti-SPAC959.03c, Anti-U three protein 7, Anti-U3 snoRNA-associated protein 7, Anti-Probable U3 small nucleolar...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
ab 1.529,00 €
Bewerten
1 von 2 Seiten