Zu "K14719" wurden 19 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-SLC39A13
Artikelnummer: ATA-HPA043971.100
Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 92% and to rat: 88%
| Schlagworte: | Anti-ZIP13, Anti-ZIP-13, Anti-LZT-Hs9, Anti-SLC39A13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Zinc transporter ZIP13 (Slc39a13), partial, rat, recombinant
Artikelnummer: CSB-EP644804RA.1
Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 130-233aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: WAYTCNISPG VEGQSLQRQQ QLGLWVIAGF LTFLALEKMF LNCKEEDPSQ APSKDPTAAA LNGGHCLAQP AAEPGLRAVV RNLKVSGYLN LLANTIDNFT HGLA. Purity: Greater than 90% as...
| Schlagworte: | Zip13, ZIP-13, Slc39a13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13,... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
| MW: | 41.2 kD |
ab 292,00 €
Human SLC39A13 (Zinc transporter ZIP13) ELISA Kit
Artikelnummer: G-AEKE02971.96
Human SLC39A13 (Zinc transporter ZIP13) ELISA Kit is a high quality kit for research use only from Assay Genie. The Human SLC39A13 (Zinc transporter ZIP13) ELISA Kit comes in a 96 Assays format and reacts against Human samples. We ship this kit on Gel Pack and kits should be stored at 2-8°C Protein Function:...
| Schlagworte: | SLC39A13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13, LIV-1 subfamily of ZIP... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
694,00 €
Anti-slc39a13
Artikelnummer: CSB-PA806319XA01DIL.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-zip13, Anti-ZIP-13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute carrier family 39... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Danio rerio (Zebrafish) (Brachydanio rerio) |
ab 1.529,00 €
Human SLC39A13 (Zinc transporter ZIP13) ELISA Kit
Artikelnummer: ELK-ELK0340.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human SLC39A13. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human SLC39A13....
| Schlagworte: | ZIP13, ZIP-13, LZT-Hs9, SLC39A13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
Slc39a13, Recombinant, Rat, aa130-233, His-GST-Tag (Zinc...
Artikelnummer: 375323.100
Acts as a zinc-influx transporter. Source: Recombinant protein corresponding to aa130-233 from rat Slc39a13, fused to His-GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD, AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA,...
| Schlagworte: | Zip13, ZIP-13, Slc39a13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13 |
| MW: | 41,2 |
ab 690,00 €
Anti-ZIP6
Artikelnummer: 600-401-GF1
Anti-ZIP6 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with ZIP6 from other sources has not been determined. Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium]
| Schlagworte: | Anti-ZIP13, Anti-ZIP-13, Anti-LZT-Hs9, Anti-SLC39A13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13,... |
| Anwendung: | ELISA, IHC, IFM, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
848,00 €
SLC39A13, Human solute carrier family 39 (zinc...
Artikelnummer: VHPS-8564
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | ZIP13, ZIP-13, LZT-Hs9, SLC39A13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member... |
| Anwendung: | RNA quantification |
45,00 €
Slc39A13, Mouse solute carrier family 39 (metal ion...
Artikelnummer: VMPS-6044
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Zip13, ZIP-13, Slc39a13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13 |
| Anwendung: | RNA quantification |
45,00 €
Slc39A13, Rat solute carrier family 39 (metal ion...
Artikelnummer: VRPS-5756
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Zip13, ZIP-13, Slc39a13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member 13 |
| Anwendung: | RNA quantification |
54,00 €
Anti-Slc39a13
Artikelnummer: G-PACO35854.50
Slc39a13 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Rat and for use in ELISA applications. Slc39a13 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium]
| Schlagworte: | Anti-Zip13, Anti-ZIP-13, Anti-Slc39a13, Anti-Zinc transporter ZIP13, Anti-Zrt- and Irt-like protein 13, Anti-Solute... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Rat |
313,00 €
SLC39A13 PrEST Antigen
Artikelnummer: ATA-APrEST83677.100
Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ZIP13, ZIP-13, LZT-Hs9, SLC39A13, Zinc transporter ZIP13, Zrt- and Irt-like protein 13, Solute carrier family 39 member... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €