Zu "K13123" wurden 14 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-GPATCH1
Artikelnummer: ATA-HPA043430.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 85% and to rat: 85%
| Schlagworte: | Anti-ECGP, Anti-GPATCH1, Anti-G patch domain-containing protein 1, Anti-Evolutionarily conserved G-patch domain-containing... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-GPATCH1
Artikelnummer: ATA-HPA043604.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 88% and to rat: 88%
| Schlagworte: | Anti-ECGP, Anti-GPATCH1, Anti-G patch domain-containing protein 1, Anti-Evolutionarily conserved G-patch domain-containing... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 246,00 €
Anti-GPATCH1
Artikelnummer: ATA-HPA074327.100
Polyclonal Antibody against Human GPATCH1, Gene description: G-patch domain containing 1, Alternative Gene Names: ECGP, FLJ10206, FLJ38686, GPATC1, Validated applications: ICC, Uniprot ID: Q9BRR8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 86% Rat...
| Schlagworte: | Anti-ECGP, Anti-GPATCH1, Anti-G patch domain-containing protein 1, Anti-Evolutionarily conserved G-patch domain-containing... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Anti-R07E5.1
Artikelnummer: CSB-PA631391XA01CXY.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-G patch domain-containing protein 1 homolog, R07E5.1 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Caenorhabditis elegans |
1.529,00 €
GPATCH1 (human), recombinant protein
Artikelnummer: ABS-PP-6825-L.100
| Schlagworte: | G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein, Recombinant Human GPATCH1... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19 kD |
ab 115,00 €
GPATCH1 PrEST Antigen
Artikelnummer: ATA-APrEST82457.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ECGP, GPATCH1, G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
GPATCH1 PrEST Antigen
Artikelnummer: ATA-APrEST82458.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ECGP, GPATCH1, G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
GPATCH1 (human), recombinant protein
Artikelnummer: ABS-PP-6825.100
| Schlagworte: | G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein, Recombinant Human GPATCH1... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19 kD |
ab 90,00 €
GPATCH1 PrEST Antigen
Artikelnummer: ATA-APrEST95616.100
PrEST Antigen GPATCH1, Gene description: G-patch domain containing 1, Alternative Gene Names: ECGP, FLJ10206, FLJ38686, GPATC1, Antigen sequence: RYVGKILDGFSLASKPLSSKKIYPPPELPRDYRPVHYFRPMVAATSENSHLLQVLSESAGKATPDPGTHSKHQLNASKRAELLGETPIQGSATSVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Schlagworte: | ECGP, GPATCH1, G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-TGH
Artikelnummer: CSB-PA132900XA01DOA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-Protein TOUGH, Anti-G patch domain-containing protein TGH, TGH Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Arabidopsis thaliana (Mouse-ear cress) |
ab 1.529,00 €
Anti-Os06g0489200
Artikelnummer: CSB-PA195174XA01OFG.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-Protein TOUGH homolog, Anti-G patch domain-containing protein TGH homolog, Os06g0489200 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Oryza sativa subsp. japonica (Rice) |
ab 1.529,00 €
Anti-R07E5.1
Artikelnummer: CSB-PA631391XA01CXY.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-G patch domain-containing protein 1 homolog, R07E5.1 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Caenorhabditis elegans |
ab 1.529,00 €