- Suchergebnis für K11856
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K11856" wurden 14 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: TGM-TMPH-04177-100ug
Description: USP43 Protein, Human, Recombinant (His) is expressed in E. coli with N-10xHis. The accession number is Q70EL4.
| Schlagworte: | USP43 , Ubiquitin carboxyl-terminal hydrolase 43 , Ubiquitin-specific-processing protease 43 , Deubiquitinating enzyme 43... |
| MW: | 74.5 kD |
ab 93,00 €
Artikelnummer: ATA-HPA023389.100
Protein function: May recognize and hydrolyze the peptide bond at the C- terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest...
| Schlagworte: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: CSB-EP758219HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 101-710aa. Protein Length: Partial. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: QGLKNHGNTC FMNAVVQCLS NTDLLAEFLA LGRYRAAPGR AEVTEQLAAL VRALWTREYT PQLSAEFKNA VSKYGSQFQG NSQHDALEFL LWLLDRVHED LEGSSRGPVS EKLPPEATKT SENCLSPSAQ LPLGQSFVQS...
| Schlagworte: | USP43, EC=3.4.19.12, Ubiquitin thioesterase 43, Deubiquitinating enzyme 43, Ubiquitin carboxyl-terminal hydrolase 43,... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 74.5 kD |
ab 292,00 €
Artikelnummer: CSB-PA007025.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 126,00 €
Artikelnummer: CSB-PA153033.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
284,00 €
Artikelnummer: ATA-HPA027763.100
Polyclonal Antibody against Human USP43, Gene description: ubiquitin specific peptidase 43, Alternative Gene Names: FLJ30626, Validated applications: ICC, Uniprot ID: Q70EL4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May recognize and hydrolyze the...
| Schlagworte: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA027763.25
Polyclonal Antibody against Human USP43, Gene description: ubiquitin specific peptidase 43, Alternative Gene Names: FLJ30626, Validated applications: ICC, Uniprot ID: Q70EL4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May recognize and hydrolyze the...
| Schlagworte: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: 043673.200
USP43 may recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins (By similarity). Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000,...
| Schlagworte: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ATA-APrEST75715.100
Protein function: May recognize and hydrolyze the peptide bond at the C- terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | USP43, EC=3.4.19.12, Ubiquitin thioesterase 43, Deubiquitinating enzyme 43, Ubiquitin carboxyl-terminal hydrolase 43,... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES4716.100
catalytic activity:Ubiquitin C-terminal thioester + H(2)O = ubiquitin + a thiol.,function:May recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins.,similarity:Belongs to the peptidase C19...
| Schlagworte: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: ABS-PP-7433.100
Protein function: May recognize and hydrolyze the peptide bond at the C- terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. [The UniProt Consortium]
| Schlagworte: | Ubiquitin carboxyl-terminal hydrolase 43, Deubiquitinating enzyme 43, Ubiquitin thioesterase 43,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST96126.100
PrEST Antigen USP43, Gene description: ubiquitin specific peptidase 43, Alternative Gene Names: FLJ30626, Antigen sequence: EEDLNTIAEGDNVYAFQVPPSPSQGTLSAHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFLIREDRAVSWAQLQQSILSKVRHLMKSEAPVQNLGSLFSIRVVGLSVACSYLSPKD, Storage: Upon delivery store at -20°C. Avoid repeated...
| Schlagworte: | USP43, EC=3.4.19.12, Ubiquitin thioesterase 43, Deubiquitinating enzyme 43, Ubiquitin carboxyl-terminal hydrolase 43,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €