Zu "K11666" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-INO80B
Artikelnummer: ATA-HPA070644.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 95% and to rat: 96%
| Schlagworte: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-INO80B
Artikelnummer: ATA-HPA078274.100
Polyclonal Antibody against Human INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Validated applications: ICC, Uniprot ID: Q9C086, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Schlagworte: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
INO80B (human), recombinant protein
Artikelnummer: ABS-PP-10455-L.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]
| Schlagworte: | INO80 complex subunit B, High mobility group AT-hook 1-like 4, IES2 homolog, hIes2, PAP-1-associated protein 1, PAPA-1,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 24.5 kD |
ab 115,00 €
HMGA1L4, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-4177
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | hIes2, PAPA-1, INO80B, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Anwendung: | RNA quantification |
45,00 €
Anti-IN80B, ID (INO80B, HMGA1L4, PAPA1, ZNHIT4, INO80...
Artikelnummer: 037040.200
IN80B induces growth and cell cycle arrests at the G1 phase of the cell cycle. Applications: Suitable for use in Western Blot, Flow Cytometry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Flow Cytometry: 1:10-50, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...
| Schlagworte: | Anti-hIes2, Anti-INO80B, Anti-PAPA-1, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Anwendung: | ELISA, FC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
INO80B PrEST Antigen
Artikelnummer: ATA-APrEST94334.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | hIes2, PAPA-1, INO80B, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-INO80B
Artikelnummer: ARG44454.50
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]
| Schlagworte: | Anti-hIes2, Anti-hIes2, Anti-INO80B, Anti-PAPA-1, Anti-PAPA-1, Anti-HMGA1L4, Anti-IES2 homolog, Anti-IES2 homolog,... |
| Anwendung: | FC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
551,00 €
INO80B (Vector pUC, Accession No. BC050666)
Artikelnummer: CSB-CL011725HU.10
Length: 1032 Sequence: atggaggccc ctgagccggg agaagccctg gagttgagcc tggcgggtgc ccatggccat ggagtgcaca agaaaaaaca caagaagcac aagaagaaac acaagaagaa acaccatcag gaagaagacg ccgggcccac gcagccgtcc cctgccaagc ctcagctcaa actcaaaatc aagcttgggg gacaagtcct ggggaccaag agtgttccta ccttcactgt gatcccagag gggcctcgct caccctctcc...
| Schlagworte: | hIes2, INO80B, PAPA-1, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
386,00 €
INO80B (human), recombinant protein
Artikelnummer: ABS-PP-10455.100
Protein function: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. [The UniProt Consortium]
| Schlagworte: | INO80 complex subunit B, High mobility group AT-hook 1-like 4, IES2 homolog, hIes2, PAP-1-associated protein 1, PAPA-1,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 24.5 kD |
ab 90,00 €
INO80B PrEST Antigen
Artikelnummer: ATA-APrEST95967.100
PrEST Antigen INO80B, Gene description: INO80 complex subunit B, Alternative Gene Names: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4, Antigen sequence: HKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Schlagworte: | hIes2, PAPA-1, INO80B, HMGA1L4, IES2 homolog, INO80 complex subunit B, PAP-1-associated protein 1, High mobility group... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-INO80B / INO80 complex subunit B
Artikelnummer: NSJ-RQ8607
0.5mg/ml if reconstituted with 0.2ml sterile DI water. INO80 complex subunit B is a protein that in humans is encoded by the INO80B gene. This gene encodes a subunit of an ATP-dependent chromatin remodeling complex, INO80, which plays a role in DNA and nucleosome-activated ATPase activity and ATP-dependent...
| Schlagworte: | Anti-hIes2, Anti-PAPA-1, Anti-INO80B, Anti-HMGA1L4, Anti-IES2 homolog, Anti-INO80 complex subunit B, Anti-PAP-1-associated... |
| Anwendung: | WB, FC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
790,00 €