Zu "K10097" wurden 21 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-LGALS14
Artikelnummer: G-PACO39478.50
LGALS14 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. LGALS14 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt...
| Schlagworte: | Anti-CLC2, Anti-PPL13, Anti-Gal-14, Anti-LGALS14, Anti-Galectin-14, Anti-Placental protein 13-like, Anti-Charcot-Leyden... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
313,00 €
Human Galectin 14 recombinant protein (His-tagged)
Artikelnummer: ARG70467.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Schlagworte: | CLC2, CLC2, PPL13, Gal-14, Gal-14, LGALS14, Galectin-14, Galectin-14, Placental protein 13-like, Placental protein... |
| Anwendung: | SDS-PAGE |
| Ursprungsart: | human |
ab 370,00 €
Human LGALS14, recombinant (C-6His)
Artikelnummer: NOV-C803.10ug
Recombinant Human Galectin-14 is produced by our Mammalian expression system and the target gene encoding Met1-Asp139 is expressed with a 6His tag at the C-terminus. Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Schlagworte: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2, Recombinant Human... |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 17.1 kD |
ab 150,00 €
Anti-LGALS14, recombinant antibody
Artikelnummer: ABS-RC-5373.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Schlagworte: | Anti-CLC2, Anti-PPL13, Anti-Gal-14, Anti-LGALS14, Anti-Galectin-14, Anti-Placental protein 13-like, Anti-Charcot-Leyden... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | rat |
ab 232,00 €
LGALS14 (human), recombinant protein
Artikelnummer: ABS-PP-3239-L.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Schlagworte: | Placental protein 13-like, Charcot-Leyden crystal protein 2, CLC2, Galectin-14, Gal-14, Recombinant Human LGALS14 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 17 kD |
ab 115,00 €
PPL13, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-7141
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Anwendung: | RNA quantification |
45,00 €
Anti-Galectin-14 (LGALS14 lectin, galactoside-binding,...
Artikelnummer: G1044-71.100
Galectin-14, also known as placental protein 13-like (PPL13), belongs the galectin family of carbohydrate binding proteins. It is expressed intracellularly in placenta and eosinophils and is released by eosinophils following allergen stimulation. Galectin-14 may be involved in the development of allergic...
| Schlagworte: | Anti-Gal-14 |
| Anwendung: | WB |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human, mouse |
969,00 €
Galectin-14, His Tag, human recombinant (rHuLGALS14-His)
Artikelnummer: 97458.1
Human recombinant LGALS14 fused with a 23 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 162 amino acids (1-139) and having a molecular mass of 18.5kDa. Galectin14, aka LGALS14, is a member of the galectin family of carbohydrate binding proteins....
| Schlagworte: | Placental protein 13-like, Charcot-Leyden crystal protein 2, CLC2, Galectin-14, Gal-14, LGALS14, PPL13, MGC22235. |
| Anwendung: | Bioassay |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18500 D |
ab 105,00 €
LGALS14 PrEST Antigen
Artikelnummer: ATA-APrEST94908.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-LGALS14
Artikelnummer: ATA-HPA065180.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
| Schlagworte: | Anti-CLC2, Anti-PPL13, Anti-Gal-14, Anti-LGALS14, Anti-Galectin-14, Anti-Placental protein 13-like, Anti-Charcot-Leyden... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Galectin-14 protein(N-His) (recombinant human)
Artikelnummer: E-PKSH034189.100
Sequence: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Binds beta-galactoside and lactose. Strong...
| Schlagworte: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2, Recombinant Human... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 16.92 kD |
ab 241,00 €
Recombinant Human Galectin4/LGALS14 Protein (His Tag)...
Artikelnummer: G-RPES4613.10
Human Galectin4/LGALS14 Recombinant Protein (RPES4613) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Schlagworte: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
248,00 €