- Suchergebnis für K09642
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K09642" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: E-AB-17117.120
Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position (By similarity). Protein function: Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position. [The UniProt Consortium]
| Schlagworte: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.-, TMPRSS11E Polyclonal Antibody |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 89,00 €
Artikelnummer: NSJ-F40096-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. TMPRSS11E is a serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position (By similarity). Protein function: Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a...
| Schlagworte: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.-, TMPRSS11E2 Antibody |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 361,00 €
Artikelnummer: ATA-HPA051062.100
Protein function: Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 75% and to rat: 74%
| Schlagworte: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.- |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: CSB-PA179468.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: TMPRSS11E. Antigen Species: Human
| Schlagworte: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.-, TMPRSS11E antibody, DESC1 antibody, TMPRSS11E2 antibody, UNQ742/PRO1461 antibody,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA744019.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: TMPRSS11E. Antigen Species: Human
| Schlagworte: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.-, TMPRSS11E antibody, DESC1 antibody, TMPRSS11E2 antibody, UNQ742/PRO1461 antibody,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: ATA-HPA043816.100
Polyclonal Antibody against Human TMPRSS11E, Gene description: transmembrane serine protease 11E, Alternative Gene Names: DESC1, TMPRSS11E2, Validated applications: ICC, Uniprot ID: Q9UL52, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Serine protease...
| Schlagworte: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.- |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: VHPS-2553
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | DESC1, TMPRSS11E, EC=3.4.21.-, Serine protease DESC1, Transmembrane protease serine 11E, Transmembrane protease serine... |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: 043048.200
TMPRSS11E is serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position (By similarity). Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C...
| Schlagworte: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.- |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: 043049.200
TMPRSS11E is a serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position (By similarity). Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at...
| Schlagworte: | Anti-DESC1, Anti-TMPRSS11E, EC=3.4.21.- |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ATA-APrEST83233.100
Protein function: Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | DESC1, TMPRSS11E, EC=3.4.21.- |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: CSB-CL892142HU.10
Length: 1272 Sequence: ATGATGTATC GGCCAGATGT GGTGAGGGCT AGGAAAAGAG TTTGTTGGGA ACCCTGGGTT ATCGGCCTCG TCATCTTCAT ATCCCTGATT GTCCTGGCAG TGTGCATTGG ACTCACTGTT CATTATGTGA GATATAATCA AAAGAAGACC TACAATTACT ATAGCACATT GTCATTTACA ACTGACAAAC TATATGCTGA GTTTGGCAGA GAGGCTTCTA ACAATTTTAC AGAAATGAGC CAGAGACTTG AATCAATGGT...
| Schlagworte: | DESC1, TMPRSS11E, EC=3.4.21.- |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Artikelnummer: ATA-APrEST96228.100
PrEST Antigen TMPRSS11E, Gene description: transmembrane serine protease 11E, Alternative Gene Names: DESC1, TMPRSS11E2, Antigen sequence: NQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFSQQKHGV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Serine...
| Schlagworte: | DESC1, TMPRSS11E, EC=3.4.21.- |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €