- Suchergebnis für K09547
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K09547" wurden 8 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA053091.100
Polyclonal Antibody against Human HSPB9, Gene description: heat shock protein family B (small) member 9, Alternative Gene Names: CT51, Validated applications: ICC, Uniprot ID: Q9BQS6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 55% Rat gene identity:...
| Schlagworte: | Anti-CT51, Anti-HSPB9, Anti-HspB9, Anti-Cancer/testis antigen 51, Anti-Heat shock protein beta-9 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA053091.25
Polyclonal Antibody against Human HSPB9, Gene description: heat shock protein family B (small) member 9, Alternative Gene Names: CT51, Validated applications: ICC, Uniprot ID: Q9BQS6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 55% Rat gene identity:...
| Schlagworte: | Anti-CT51, Anti-HSPB9, Anti-HspB9, Anti-Cancer/testis antigen 51, Anti-Heat shock protein beta-9 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: VHPS-4335
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | CT51, HspB9, HSPB9, Cancer/testis antigen 51, Heat shock protein beta-9 |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: VMPS-2961
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | HspB9, Hspb9, Heat shock protein beta-9 |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: VRPS-2831
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Hspb9, rCG_34639, Hspb9_predicted, Heat shock protein, alpha-crystallin-related, B9 (Predicted) |
| Anwendung: | RNA quantification |
54,00 €
Artikelnummer: 036808.200
The function of this protein remains unknown. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for...
| Schlagworte: | Anti-CT51, Anti-HSPB9, Anti-HspB9, Anti-Cancer/testis antigen 51, Anti-Heat shock protein beta-9 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ELK-ES10699.100
similarity:Belongs to the small heat shock protein (HSP20) family.,tissue specificity:Testis specific., Recommended dilutions: WB 1:500-2000 ELISA 1:5000-20000. Cellular localization: Cytoplasm . Nucleus . Translocates to nuclear foci during heat shock.
| Schlagworte: | Anti-CT51, Anti-HSPB9, Anti-HspB9, Anti-Cancer/testis antigen 51, Anti-Heat shock protein beta-9, HSPB9 rabbit pAb |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Artikelnummer: ATA-APrEST95651.100
PrEST Antigen HSPB9, Gene description: heat shock protein family B (small) member 9, Alternative Gene Names: CT51, Antigen sequence: TGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 55% Rat...
| Schlagworte: | CT51, HSPB9, HspB9, Cancer/testis antigen 51, Heat shock protein beta-9 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €