Zu "K08119" wurden 7 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ECM2
Anti-ECM2

Artikelnummer: ATA-HPA035347.100

Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 69% and to rat: 69%
Schlagworte: Anti-ECM2, Anti-Matrix glycoprotein SC1/ECM2, Anti-Extracellular matrix protein 2
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
Anti-ECM2
Anti-ECM2

Artikelnummer: ATA-HPA035348.100

Polyclonal Antibody against Human ECM2, Gene description: extracellular matrix protein 2, Validated applications: ICC, Uniprot ID: O94769, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt...
Schlagworte: Anti-ECM2, Anti-Matrix glycoprotein SC1/ECM2, Anti-Extracellular matrix protein 2
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
ECM2, Human extracellular matrix protein 2, female organ and adipocyte specific, Real Time PCR Prime
ECM2, Human extracellular matrix protein 2, female organ...

Artikelnummer: VHPS-2834

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: ECM2, Matrix glycoprotein SC1/ECM2, Extracellular matrix protein 2
Anwendung: RNA quantification
45,00 €
Bewerten
Ecm2, Mouse extracellular matrix protein 2, female organ and adipocyte specific, Real Time PCR Prime
Ecm2, Mouse extracellular matrix protein 2, female organ...

Artikelnummer: VMPS-1824

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: Ecm2, Tenonectin, Extracellular matrix protein 2
Anwendung: RNA quantification
45,00 €
Bewerten
ECM2 PrEST Antigen
ECM2 PrEST Antigen

Artikelnummer: ATA-APrEST75192.100

Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: ECM2, Matrix glycoprotein SC1/ECM2, Extracellular matrix protein 2
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-ECM2
Anti-ECM2

Artikelnummer: ELK-ES19310.100

Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization: Secreted, extracellular space, extracellular matrix .
Schlagworte: Anti-ECM2, Anti-Matrix glycoprotein SC1/ECM2, Anti-Extracellular matrix protein 2, ECM2 rabbit pAb
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 173,00 €
Bewerten
ECM2 PrEST Antigen
ECM2 PrEST Antigen

Artikelnummer: ATA-APrEST95917.100

PrEST Antigen ECM2, Gene description: extracellular matrix protein 2, Antigen sequence: RVLCDETMCHPQRCPQTVIPEGECCPVCSATEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt...
Schlagworte: ECM2, Matrix glycoprotein SC1/ECM2, Extracellular matrix protein 2
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten