Zu "K08119" wurden 7 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ECM2
Artikelnummer: ATA-HPA035347.100
Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 69% and to rat: 69%
| Schlagworte: | Anti-ECM2, Anti-Matrix glycoprotein SC1/ECM2, Anti-Extracellular matrix protein 2 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-ECM2
Artikelnummer: ATA-HPA035348.100
Polyclonal Antibody against Human ECM2, Gene description: extracellular matrix protein 2, Validated applications: ICC, Uniprot ID: O94769, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt...
| Schlagworte: | Anti-ECM2, Anti-Matrix glycoprotein SC1/ECM2, Anti-Extracellular matrix protein 2 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
ECM2, Human extracellular matrix protein 2, female organ...
Artikelnummer: VHPS-2834
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | ECM2, Matrix glycoprotein SC1/ECM2, Extracellular matrix protein 2 |
| Anwendung: | RNA quantification |
45,00 €
Ecm2, Mouse extracellular matrix protein 2, female organ...
Artikelnummer: VMPS-1824
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Ecm2, Tenonectin, Extracellular matrix protein 2 |
| Anwendung: | RNA quantification |
45,00 €
ECM2 PrEST Antigen
Artikelnummer: ATA-APrEST75192.100
Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ECM2, Matrix glycoprotein SC1/ECM2, Extracellular matrix protein 2 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-ECM2
Artikelnummer: ELK-ES19310.100
Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization: Secreted, extracellular space, extracellular matrix .
| Schlagworte: | Anti-ECM2, Anti-Matrix glycoprotein SC1/ECM2, Anti-Extracellular matrix protein 2, ECM2 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
ECM2 PrEST Antigen
Artikelnummer: ATA-APrEST95917.100
PrEST Antigen ECM2, Gene description: extracellular matrix protein 2, Antigen sequence: RVLCDETMCHPQRCPQTVIPEGECCPVCSATEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt...
| Schlagworte: | ECM2, Matrix glycoprotein SC1/ECM2, Extracellular matrix protein 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €