Zu "K05040" wurden 16 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-SLC6A7
Artikelnummer: ATA-HPA063773.100
Polyclonal Antibody against Human SLC6A7, Gene description: solute carrier family 6 member 7, Alternative Gene Names: PROT, Validated applications: ICC, Uniprot ID: Q99884, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Terminates the action of proline by...
| Schlagworte: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
Anti-SLC6A7
Artikelnummer: CSB-PA04209A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: SLC6A7. Antigen Species: Human
| Schlagworte: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-SLC6A7
Artikelnummer: CSB-PA211832.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: SLC6A7. Antigen Species: Human
| Schlagworte: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat |
ab 167,00 €
Anti-SLC6A7
Artikelnummer: CSB-PA577390.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: SLC6A7. Antigen Species: Human
| Schlagworte: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat |
ab 167,00 €
Anti-SLC6A7
Artikelnummer: E-AB-16846.120
This gene is a member of the gamma-aminobutyric acid (GABA) neurotransmitter gene family and encodes a high-affinity mammalian brain L-proline transporter protein. This transporter protein differs from other sodium-dependent plasma membrane carriers by its pharmacological specificity, kinetic properties, and ionic...
| Schlagworte: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, SLC6A7... |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat |
ab 89,00 €
Anti-SLC6A7
Artikelnummer: ATA-HPA028907.100
Protein function: Terminates the action of proline by its high affinity sodium- dependent reuptake into presynaptic terminals. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 88% and to rat: 89%
| Schlagworte: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 239,00 €
SLC6A7 PrEST Antigen
Artikelnummer: ATA-APrEST96102.100
PrEST Antigen SLC6A7, Gene description: solute carrier family 6 member 7, Alternative Gene Names: PROT, Antigen sequence: REEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQSPKPLMVHMRKYGGITSFENTAIEVDREIA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Terminates the action of...
| Schlagworte: | PROT, SLC6A7, Solute carrier family 6 member 7, Sodium-dependent proline transporter |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
SLC6A7 (Vector pENTR223.1, Accession No. BC113425)
Artikelnummer: CSB-CL858729HU.10
Length: 1911 Sequence: ATGAAGAAGC TCCAGGGAGC TCACCTCCGC AAGCCTGTCA CCCCAGACCT GCTGATGACC CCCAGTGACC AGGGCGATGT CGACCTGGAT GTGGACTTTG CTGCACACCG GGGGAACTGG ACAGGCAAGC TGGACTTCCT GCTGTCCTGC ATTGGCTACT GTGTAGGCCT GGGGAATGTC TGGCGCTTCC CCTATCGAGC GTACACCAAT GGAGGAGGCG CCTTCCTCGT GCCCTACTTC CTCATGCTGG CCATCTGTGG...
| Schlagworte: | PROT, SLC6A7, Solute carrier family 6 member 7, Sodium-dependent proline transporter |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
357,00 €
Anti-SLC6A7, HRP conjugated
Artikelnummer: CSB-PA04209B0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: SLC6A7. Antigen Species: Human
| Schlagworte: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-SLC6A7, FITC conjugated
Artikelnummer: CSB-PA04209C0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: SLC6A7. Antigen Species: Human
| Schlagworte: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-SLC6A7, Biotin conjugated
Artikelnummer: CSB-PA04209D0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: SLC6A7. Antigen Species: Human
| Schlagworte: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
SLC6A7, Human solute carrier family 6 (neurotransmitter...
Artikelnummer: VHPS-8599
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | PROT, SLC6A7, Solute carrier family 6 member 7, Sodium-dependent proline transporter |
| Anwendung: | RNA quantification |
44,00 €