Zu "K04990" wurden 18 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-PKD2L1
Artikelnummer: ATA-HPA070002.100
Polyclonal Antibody against Human PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Validated applications: ICC, Uniprot ID: Q9P0L9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
| Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
Anti-PKD2L1
Artikelnummer: CSB-PA214505.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
| Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-PKD2L1
Artikelnummer: CSB-PA960366.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
| Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Phenamil (methanesulfonate)
Artikelnummer: Cay14308-5
Phenamil is an inhibitor of transient receptor potential polycystin-L (TRPP3, IC50 = 140 nM) and a derivative of amiloride (Cay-14409). It also inhibits the epithelial sodium channel (ENaC, IC50 = 400 nM). Phenamil decreases basal short-circuit currents in human and ovine bronchial epithelial cells with IC50 values...
| Schlagworte: | 3,5-diamino-6-chloro-N-[imino(phenylamino)methyl]-2-pyrazinecarboxamide, monomethanesulfonate |
| Anwendung: | TRPP3 inhibitor |
| CAS | 1161-94-0 |
| MW: | 401.8 D |
ab 85,00 €
NEU
Nanodisc Human PK2L1-Strep Protein
Artikelnummer: G-HDFP1396.10
Protein function: Pore-forming subunit of a heterotetrameric, non-selective cation channel that is permeable to Ca(2+) (PubMed:10517637, PubMed:11959145, PubMed:25820328, PubMed:27754867, PubMed:29425510, PubMed:23212381, PubMed:30004384). Pore-forming subunit of a calcium- permeant ion channel formed by PKD1L2 and...
| Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
1.336,00 €
NEU
Nanodisc Human PK2L1 Protein
Artikelnummer: G-HDFP681.10
Protein function: Pore-forming subunit of a heterotetrameric, non-selective cation channel that is permeable to Ca(2+) (PubMed:10517637, PubMed:11959145, PubMed:25820328, PubMed:27754867, PubMed:29425510, PubMed:23212381, PubMed:30004384). Pore-forming subunit of a calcium- permeant ion channel formed by PKD1L2 and...
| Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
1.486,00 €
Human PK2L1 full length protein-synthetic nanodisc
Artikelnummer: DIM-FLP100773.10
This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation...
| Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
| Anwendung: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 92 kD |
ab 1.291,00 €
Human PK2L1-Strep full length protein-synthetic nanodisc
Artikelnummer: DIM-FLP120773.10
This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation...
| Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
| Anwendung: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 92 kD |
ab 1.162,00 €
PKD2L1 (human), recombinant protein
Artikelnummer: ABS-PP-5501.20
| Schlagworte: | Polycystin-2-like protein 1, Polycystin-2L1, Polycystic kidney disease 2-like 1 protein, Polycystin-2 homolog,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 29.5 kD |
ab 90,00 €
PKD2L1 PrEST Antigen
Artikelnummer: ATA-APrEST96085.100
PrEST Antigen PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Antigen sequence: YNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
Anti-PKD2L1
Artikelnummer: CSB-PA018062GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
| Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
Anti-PKD2L1
Artikelnummer: CSB-PA865199DSR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
| Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €