- Suchergebnis für K02959
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K02959" wurden 48 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA050081.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 88%
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | WB, IHC, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ATA-HPA054538.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to rat: 95%
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: CSB-EP897105HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-137aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VAAHNKCPRD GRFVEQLGSY DPLPNSHGEK LVALNLDRIR HWIGCGAHLS KPMEKLLGLA GFFPLHPMMI TNAERLRRKR AREVLLASQK TDAEATDTEA TET. Purity: Greater than 90% as determined...
| Schlagworte: | S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 38.5 kD |
ab 292,00 €
Artikelnummer: CSB-PA869890.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
284,00 €
Artikelnummer: E-AB-62435.120
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 243,00 €
Artikelnummer: CSB-PA654632XA01FPY.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-Synpcc7942_1772, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2) |
ab 1.529,00 €
Artikelnummer: CSB-PA484118XA01ENM.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-EC55989_2898, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Escherichia coli (strain 55989 / EAEC) |
ab 1.529,00 €
Artikelnummer: CSB-PA424059XA01EJD.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-EcE24377A_2893, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Escherichia coli O139:H28 (strain E24377A / ETEC) |
ab 1.529,00 €
Artikelnummer: CSB-PA483004XA01EOB.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-E2348C_2898, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Escherichia coli O127:H6 (strain E2348/69 / EPEC) |
ab 1.529,00 €
Artikelnummer: CSB-PA485352XA01EOP.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-ECED1_3048, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Escherichia coli O81 (strain ED1a) |
ab 1.529,00 €
Artikelnummer: CSB-PA487800XA01EOK.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-ECS88_2795, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Escherichia coli O45:K1 (strain S88 / ExPEC) |
ab 1.529,00 €
Artikelnummer: 374275.100
Source:, Recombinant protein corresponding to aa1-137 from human MRPS16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.5kD, AA Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET, Storage and Stability: May be stored at 4°C...
| Schlagworte: | S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
| MW: | 38,5 |
ab 690,00 €