Zu "K02959" wurden 10 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPS16
Anti-MRPS16

Artikelnummer: E-AB-62435.120

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 198,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: G-CAB9874.100

Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 352,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: ATA-HPA050081.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 88%
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB, IHC, ICC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 335,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: ATA-HPA054538.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to rat: 95%
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 335,00 €
Bewerten
-10 %
Rabattaktion
Anti-MRP-S16
Anti-MRP-S16

Artikelnummer: ELK-ES6492.100

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-Small ribosomal subunit protein bS16m, Anti-28S...
Anwendung: WB, IHC, IF, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
169,00 € ab 152,10 €
Bewerten
MRPS16 PrEST Antigen
MRPS16 PrEST Antigen

Artikelnummer: ATA-APrEST84675.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: S16mt, RPMS16, MRPS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit...
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
247,00 €
Bewerten
MRPS16 PrEST Antigen
MRPS16 PrEST Antigen

Artikelnummer: ATA-APrEST84676.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: S16mt, RPMS16, MRPS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit...
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
247,00 €
Bewerten
MRPS16, Recombinant, Human, aa1-137, GST-Tag (28S Ribosomal Protein S16, Mitochondrial)
MRPS16, Recombinant, Human, aa1-137, GST-Tag (28S...

Artikelnummer: 374275.100

Source:, Recombinant protein corresponding to aa1-137 from human MRPS16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.5kD, AA Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET, Storage and Stability: May be stored at 4°C...
Schlagworte: S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit...
MW: 38,5
ab 575,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: G-CAB9874.20

MRPS16 Polyclonal Antibody (CAB9874) from Antibody Genie, is tested in WB applications.The MRPS16 Polyclonal Antibody (CAB9874) is reactive versus Human, Mouse, Rat samples.
Schlagworte: Anti-S16mt, Anti-MRPS16, Anti-RPMS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB, IF
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
149,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: ABD-8C14035.50

Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPS16 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
Schlagworte: Anti-S16mt, Anti-MRPS16, Anti-RPMS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB, IHC, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
601,00 €
Bewerten