Zu "K02959" wurden 48 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPS16
Artikelnummer: ATA-HPA050081.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 88%
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | WB, IHC, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-MRPS16
Artikelnummer: ATA-HPA054538.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to rat: 95%
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
28S ribosomal protein S16, mitochondrial (MRPS16), human,...
Artikelnummer: CSB-EP897105HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-137aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VAAHNKCPRD GRFVEQLGSY DPLPNSHGEK LVALNLDRIR HWIGCGAHLS KPMEKLLGLA GFFPLHPMMI TNAERLRRKR AREVLLASQK TDAEATDTEA TET. Purity: Greater than 90% as determined...
| Schlagworte: | S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 38.5 kD |
ab 292,00 €
Anti-MRPS16
Artikelnummer: CSB-PA869890.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
284,00 €
Anti-MRPS16
Artikelnummer: E-AB-62435.120
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 243,00 €
Anti-rpsP
Artikelnummer: CSB-PA654632XA01FPY.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-Synpcc7942_1772, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2) |
ab 1.529,00 €
Anti-rpsP
Artikelnummer: CSB-PA484118XA01ENM.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-EC55989_2898, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Escherichia coli (strain 55989 / EAEC) |
ab 1.529,00 €
Anti-rpsP
Artikelnummer: CSB-PA424059XA01EJD.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-EcE24377A_2893, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Escherichia coli O139:H28 (strain E24377A / ETEC) |
ab 1.529,00 €
Anti-rpsP
Artikelnummer: CSB-PA483004XA01EOB.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-E2348C_2898, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Escherichia coli O127:H6 (strain E2348/69 / EPEC) |
ab 1.529,00 €
Anti-rpsP
Artikelnummer: CSB-PA485352XA01EOP.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-ECED1_3048, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Escherichia coli O81 (strain ED1a) |
ab 1.529,00 €
Anti-rpsP
Artikelnummer: CSB-PA487800XA01EOK.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-ECS88_2795, Anti-30S ribosomal protein S16, Anti-Small ribosomal subunit protein bS16, rpsP Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Escherichia coli O45:K1 (strain S88 / ExPEC) |
ab 1.529,00 €
MRPS16, Recombinant, Human, aa1-137, GST-Tag (28S...
Artikelnummer: 374275.100
Source:, Recombinant protein corresponding to aa1-137 from human MRPS16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.5kD, AA Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET, Storage and Stability: May be stored at 4°C...
| Schlagworte: | S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
| MW: | 38,5 |
ab 690,00 €