Zu "K02929" wurden 29 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-RPL36AL
Artikelnummer: ARG40081.100
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
707,00 €
Anti-RPL36A
Artikelnummer: ATA-HPA077586.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 100% and to rat: 100%
| Schlagworte: | Anti-GIG15, Anti-RPL44, Anti-RPL36A, Anti-60S ribosomal protein L44, Anti-60S ribosomal protein L36a, Anti-Large ribosomal... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
60S ribosomal protein L36a-like (RPL36AL), human,...
Artikelnummer: CSB-RP018044h.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-106aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MVNVPKTRRT FCKKCGKHQP HKVTQYKKGK DSLYAQGRRR YDRKQSGYGG QTKPIFRKKA KTTKKIVLRL ECVEPNCRSK RMLAIKRCKH FELGGDKKRK GQVIQF. Purity: Greater than 90% as...
| Schlagworte: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human 60S ribosomal... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 39.5 kD |
ab 219,00 €
Anti-RPL36AL
Artikelnummer: CSB-PA01804A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-RPL36AL
Artikelnummer: CSB-PA01805A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-RPL36A
Artikelnummer: E-AB-91258.120
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
| Schlagworte: | GIG15, RPL44, RPL36A, 60S ribosomal protein L44, 60S ribosomal protein L36a, Large ribosomal subunit protein eL42, Cell... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 243,00 €
Anti-RPL36AL
Artikelnummer: E-AB-64989.120
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL Polyclonal... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 243,00 €
Anti-RPL44
Artikelnummer: CSB-PA748350XA01DOT.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-RPL44, Anti-AFR034W, Anti-60S ribosomal protein L44, Anti-Large ribosomal subunit protein eL42, RPL44 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
ab 1.529,00 €
Anti-RPL36A, CT (RPL36A, RPL44, 60S ribosomal protein...
Artikelnummer: 041212.200
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
| Schlagworte: | Anti-GIG15, Anti-RPL44, Anti-RPL36A, Anti-60S ribosomal protein L44, Anti-60S ribosomal protein L36a, Anti-Cell... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S...
Artikelnummer: 375106.1
Belongs to the ribosomal protein L44e family. Source: Recombinant protein corresponding to aa1-106 from RPL36AL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD, AA Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF,...
| Schlagworte: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like |
| MW: | 39,5 |
ab 603,00 €
RPL36A PrEST Antigen
Artikelnummer: ATA-APrEST90521.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | GIG15, RPL44, RPL36A, 60S ribosomal protein L44, 60S ribosomal protein L36a, Large ribosomal subunit protein eL42, Cell... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-RPL36AL
Artikelnummer: G-CAB14366.100
WB 1:500 - 1:2000.
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL Polyclonal... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 103,00 €