Zu "K02916" wurden 5 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPL35
Anti-MRPL35

Artikelnummer: G-PACO07202.50

MRPL35 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, WB applications. MRPL35 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-L35mt, Anti-MRPL35, Anti-BM-007, Anti-MRP-L35, Anti-39S ribosomal protein L35, mitochondrial, Anti-Mitochondrial...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
320,00 €
Bewerten
Anti-MRPL35
Anti-MRPL35

Artikelnummer: ATA-HPA043482.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 61%
Schlagworte: Anti-L35mt, Anti-MRPL35, Anti-BM-007, Anti-MRP-L35, Anti-39S ribosomal protein L35, mitochondrial, Anti-Mitochondrial...
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 335,00 €
Bewerten
-10 %
Rabattaktion
Anti-MRP-L35
Anti-MRP-L35

Artikelnummer: ELK-ES8354.100

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: Anti-L35mt, Anti-BM-007, Anti-MRPL35, Anti-MRP-L35, Anti-Large ribosomal subunit protein bL35m, Anti-39S ribosomal protein...
Anwendung: WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
169,00 € ab 152,10 €
Bewerten
MRPL35 PrEST Antigen
MRPL35 PrEST Antigen

Artikelnummer: ATA-APrEST84685.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: L35mt, MRPL35, BM-007, MRP-L35, 39S ribosomal protein L35, mitochondrial, Mitochondrial large ribosomal subunit protein bL35m
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
247,00 €
Bewerten
RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S Ribosomal Protein L35)
RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S...

Artikelnummer: 375128.100

Source:, Recombinant protein corresponding to aa7-64 from E. coli 50S Ribosomal Protein L35, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.5kD, AA Sequence: VRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLRPKAMVSKGDLGLVIACLPY, Storage and Stability: May be stored at 4°C for short-term only....
Schlagworte: rpmI, b1717, Ribosomal protein A, 50S ribosomal protein L35, Large ribosomal subunit protein bL35
MW: 33,5
ab 636,00 €
Bewerten