Zu "K02909" wurden 49 Artikel gefunden!

1 von 5 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
50S ribosomal protein L31 (rpmE), Escherichia coli, recombinant
50S ribosomal protein L31 (rpmE), Escherichia coli,...

Artikelnummer: CSB-RP088444Ba.1

Organism: Escherichia coli (strain K12). Source: E.coli. Expression Region: 1-70aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MKKDIHPKYE EITASCSCGN VMKIRSTVGH DLNLDVCSKC HPFFTGKQRD VATGGRVDRF NKRFNIPGSK. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not...
Schlagworte: rpmE, b3936, 50S ribosomal protein L31, Large ribosomal subunit protein bL31-A, Recombinant Escherichia coli 50S ribosomal...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: E.coli
MW: 34.9 kD
ab 364,00 €
Bewerten
NEU
Anti-rpmE
Anti-rpmE

Artikelnummer: CSB-PA482668XA01EOK.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-ECS88_4386, Anti-50S ribosomal protein L31, Anti-Large ribosomal subunit protein bL31, rpmE Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Escherichia coli O45:K1 (strain S88 / ExPEC)
1.529,00 €
Bewerten
NEU
Anti-rpmE2
Anti-rpmE2

Artikelnummer: CSB-PA483681XA01EOG.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-ECUMN_0329, Anti-50S ribosomal protein L31 type B, Anti-Large ribosomal subunit protein bL31B, rpmE2 Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
1.529,00 €
Bewerten
NEU
Anti-rpmE
Anti-rpmE

Artikelnummer: CSB-PA485915XA01EOR.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-EFER_3836, Anti-50S ribosomal protein L31, Anti-Large ribosomal subunit protein bL31, rpmE Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
1.529,00 €
Bewerten
NEU
Anti-rpmE2
Anti-rpmE2

Artikelnummer: CSB-PA636169XA01EGW.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-UTI89_C0314, Anti-50S ribosomal protein L31 type B, Anti-Large ribosomal subunit protein bL31B, rpmE2 Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Escherichia coli (strain UTI89 / UPEC)
1.529,00 €
Bewerten
NEU
Anti-rpmE
Anti-rpmE

Artikelnummer: CSB-PA654626XA01FPY.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-Synpcc7942_2204, Anti-50S ribosomal protein L31, Anti-Large ribosomal subunit protein bL31, rpmE Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
1.529,00 €
Bewerten
Anti-rpmE
Anti-rpmE

Artikelnummer: CSB-PA471780XA01ENW.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-ECSE_4225, Anti-50S ribosomal protein L31, Anti-Large ribosomal subunit protein bL31, rpmE Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Escherichia coli (strain SE11)
1.529,00 €
Bewerten
Anti-rpmE
Anti-rpmE

Artikelnummer: CSB-PA481208XA01EOE.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-ECH74115_5394, Anti-50S ribosomal protein L31, Anti-Large ribosomal subunit protein bL31, rpmE Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Escherichia coli O157:H7 (strain EC4115 / EHEC)
1.529,00 €
Bewerten
Anti-rpmE2
Anti-rpmE2

Artikelnummer: CSB-PA482540XA01EOO.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-ECIAI1_0296, Anti-50S ribosomal protein L31 type B, Anti-Large ribosomal subunit protein bL31B, rpmE2 Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Escherichia coli O8 (strain IAI1)
1.529,00 €
Bewerten
Anti-rpmE2
Anti-rpmE2

Artikelnummer: CSB-PA484369XA01EOK.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-ECS88_0292, Anti-50S ribosomal protein L31 type B, Anti-Large ribosomal subunit protein bL31B, rpmE2 Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Escherichia coli O45:K1 (strain S88 / ExPEC)
1.529,00 €
Bewerten
RpmE, Recombinant, E. coli, aa1-70, GST-Tag (50S Ribosomal Protein L31)
RpmE, Recombinant, E. coli, aa1-70, GST-Tag (50S...

Artikelnummer: 375123.100

Binds the 23S rRNA. Source: Recombinant protein corresponding to aa1-70 from E. coli 50S Ribosomal Protein L31, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.9kD, AA Sequence: MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK, Storage and Stability: May be stored...
Schlagworte: rpmE, b3936, 50S ribosomal protein L31, Large ribosomal subunit protein bL31-A
MW: 34,9
ab 786,00 €
Bewerten
Anti-rpmE
Anti-rpmE

Artikelnummer: CSB-PA088444ZA01ENV.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-rpmE, Anti-b3936, Anti-50S ribosomal protein L31, Anti-Large ribosomal subunit protein bL31-A, rpmE Antibody
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Escherichia coli (strain K12)
ab 1.529,00 €
Bewerten
1 von 5 Seiten