Zu "K02887" wurden 9 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPL20
Artikelnummer: E-AB-18777.120
MRPL20 is one of more than 70 protein components of mitochondrial ribosomes that are encoded by the nuclear genome. MRPL20 is a subunit of the 39S mitochondrial ribosome. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA...
| Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | WB, IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 71,00 €
Anti-MRPL20 (PACO01095)
Artikelnummer: G-PACO01095.50
MRPL20 Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. MRPL20 Antibody is Polyclonal and is a IgG isotype antibody from Assay Genie.
| Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
320,00 €
Anti-MRPL20
Artikelnummer: G-PACO22089.100
MRPL20 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB applications. MRPL20 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
448,00 €
Anti-MRPL20
Artikelnummer: G-PACO40510.50
MRPL20 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. MRPL20 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
363,00 €
Anti-MRPL20
Artikelnummer: ATA-HPA047074.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 91% and to rat: 91%
| Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | ICC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
Anti-MRP-L20
Artikelnummer: ELK-ES2834.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-Large ribosomal subunit protein bL20m, Anti-39S ribosomal protein L20,... |
| Anwendung: | WB, IHC, IF, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 169,00 €
MRPL20, Recombinant, Human, aa46-149, His-SUMO-Tag (39S...
Artikelnummer: 374269.100
Source:, Recombinant protein corresponding to aa46-149 from human MRPL20, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH, Storage and Stability: May be stored...
| Schlagworte: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m |
| MW: | 27,8 |
ab 511,00 €
MRPL20 PrEST Antigen
Artikelnummer: ATA-APrEST84684.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €
Anti-MRPL20
Artikelnummer: ABD-8C14065.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPL20 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
601,00 €