Zu "GeneID 9701" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-SAPS2
Artikelnummer: A300-970A
Protein function: Regulatory subunit of protein phosphatase 6 (PP6). May function as a scaffolding PP6 subunit. Involved in the PP6- mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. [The UniProt Consortium]
| Schlagworte: | Anti-PPP6R2, Anti-KIAA0685, Anti-SAPS domain family member 2, Anti-Serine/threonine-protein phosphatase 6 regulatory... |
| Anwendung: | WB, IP |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 165,00 €
Anti-SAPS2
Artikelnummer: A300-969A
Protein function: Regulatory subunit of protein phosphatase 6 (PP6). May function as a scaffolding PP6 subunit. Involved in the PP6- mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. [The UniProt Consortium]
| Schlagworte: | Anti-PPP6R2, Anti-KIAA0685, Anti-SAPS domain family member 2, Anti-Serine/threonine-protein phosphatase 6 regulatory... |
| Anwendung: | WB, IP |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 165,00 €
Anti-PPP6R2
Artikelnummer: ATA-HPA030656.100
Protein function: Regulatory subunit of protein phosphatase 6 (PP6). May function as a scaffolding PP6 subunit. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
| Schlagworte: | Anti-PPP6R2, Anti-KIAA0685, Anti-SAPS domain family member 2, Anti-Serine/threonine-protein phosphatase 6 regulatory... |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-PPP6R2
Artikelnummer: ATA-HPA075438.100
Polyclonal Antibody against Human PPP6R2, Gene description: protein phosphatase 6 regulatory subunit 2, Alternative Gene Names: dJ579N16.1, KIAA0685, SAP190, SAPS2, Validated applications: IHC, Uniprot ID: O75170, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Schlagworte: | Anti-PPP6R2, Anti-KIAA0685, Anti-SAPS domain family member 2, Anti-Serine/threonine-protein phosphatase 6 regulatory... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
PPP6R2 (human), recombinant protein
Artikelnummer: ABS-PP-7298-L.100
Protein function: Regulatory subunit of protein phosphatase 6 (PP6). May function as a scaffolding PP6 subunit. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. [The UniProt Consortium]
| Schlagworte: | Serine/threonine-protein phosphatase 6 regulatory subunit 2, SAPS domain family member 2, Recombinant Human PPP6R2 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 37.5 kD |
ab 115,00 €
KIAA0685, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-4914
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | PPP6R2, KIAA0685, SAPS domain family member 2, Serine/threonine-protein phosphatase 6 regulatory subunit 2 |
| Anwendung: | RNA quantification |
45,00 €
PPP6R2 PrEST Antigen
Artikelnummer: ATA-APrEST73414.100
Protein function: Regulatory subunit of protein phosphatase 6 (PP6). May function as a scaffolding PP6 subunit. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | PPP6R2, KIAA0685, SAPS domain family member 2, Serine/threonine-protein phosphatase 6 regulatory subunit 2 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-PPP6R2
Artikelnummer: G-CAB8359.20
Protein function: Regulatory subunit of protein phosphatase 6 (PP6). May function as a scaffolding PP6 subunit. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. [The UniProt Consortium]
| Schlagworte: | Anti-PPP6R2, Anti-KIAA0685, Anti-SAPS domain family member 2, Anti-Serine/threonine-protein phosphatase 6 regulatory... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
103,00 €
Anti-PP6R2
Artikelnummer: ELK-ES14003.100
Protein phosphatase regulatory subunits, such as SAPS2, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS2 is a regulatory subunit for the protein phosphatase-6 catalytic...
| Schlagworte: | Anti-PPP6R2, Anti-KIAA0685, Anti-SAPS domain family member 2, Anti-Serine/threonine-protein phosphatase 6 regulatory... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
PPP6R2 (human), recombinant protein
Artikelnummer: ABS-PP-7298.100
Protein function: Regulatory subunit of protein phosphatase 6 (PP6). May function as a scaffolding PP6 subunit. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. [The UniProt Consortium]
| Schlagworte: | Serine/threonine-protein phosphatase 6 regulatory subunit 2, SAPS domain family member 2, Recombinant Human PPP6R2 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 37.5 kD |
ab 90,00 €
PPP6R2 PrEST Antigen
Artikelnummer: ATA-APrEST95783.100
PrEST Antigen PPP6R2, Gene description: protein phosphatase 6 regulatory subunit 2, Alternative Gene Names: dJ579N16.1, KIAA0685, SAP190, SAPS2, Antigen sequence: FDEPANSTPTAPGVVRDVGSSVWAAGTSAPEEKGWAKFTDFQPFCCSESGPRCSSPVDTECSHAEGSRSQGPEKASQASYFAVSPA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Schlagworte: | PPP6R2, KIAA0685, SAPS domain family member 2, Serine/threonine-protein phosphatase 6 regulatory subunit 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €