Zu "GeneID 94086" wurden 6 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-HSPB9
Artikelnummer: ATA-HPA053091.100
Polyclonal Antibody against Human HSPB9, Gene description: heat shock protein family B (small) member 9, Alternative Gene Names: CT51, Validated applications: ICC, Uniprot ID: Q9BQS6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 55% Rat gene identity:...
| Schlagworte: | Anti-CT51, Anti-HSPB9, Anti-HspB9, Anti-Cancer/testis antigen 51, Anti-Heat shock protein beta-9 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-HSPB9
Artikelnummer: ATA-HPA053091.25
Polyclonal Antibody against Human HSPB9, Gene description: heat shock protein family B (small) member 9, Alternative Gene Names: CT51, Validated applications: ICC, Uniprot ID: Q9BQS6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 55% Rat gene identity:...
| Schlagworte: | Anti-CT51, Anti-HSPB9, Anti-HspB9, Anti-Cancer/testis antigen 51, Anti-Heat shock protein beta-9 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
HspB9, Human heat shock protein,...
Artikelnummer: VHPS-4335
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | CT51, HspB9, HSPB9, Cancer/testis antigen 51, Heat shock protein beta-9 |
| Anwendung: | RNA quantification |
45,00 €
Anti-HSPB9, ID (HSPB9, Heat shock protein beta-9,...
Artikelnummer: 036808.200
The function of this protein remains unknown. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for...
| Schlagworte: | Anti-CT51, Anti-HSPB9, Anti-HspB9, Anti-Cancer/testis antigen 51, Anti-Heat shock protein beta-9 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Anti-HSPB9
Artikelnummer: ELK-ES10699.100
similarity:Belongs to the small heat shock protein (HSP20) family.,tissue specificity:Testis specific., Recommended dilutions: WB 1:500-2000 ELISA 1:5000-20000. Cellular localization: Cytoplasm . Nucleus . Translocates to nuclear foci during heat shock.
| Schlagworte: | Anti-CT51, Anti-HSPB9, Anti-HspB9, Anti-Cancer/testis antigen 51, Anti-Heat shock protein beta-9, HSPB9 rabbit pAb |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
HSPB9 PrEST Antigen
Artikelnummer: ATA-APrEST95651.100
PrEST Antigen HSPB9, Gene description: heat shock protein family B (small) member 9, Alternative Gene Names: CT51, Antigen sequence: TGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 55% Rat...
| Schlagworte: | CT51, HSPB9, HspB9, Cancer/testis antigen 51, Heat shock protein beta-9 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €