- Suchergebnis für GeneID 93273
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 93273" wurden 10 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-PACO61394.50
LEMD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. LEMD1 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
313,00 €
Artikelnummer: ATA-HPA076708.100
Polyclonal Antibody against Human LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Validated applications: ICC, Uniprot ID: Q68G75, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 75% Rat gene identity: 75%
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: 600-401-CJ1
Anti-LEMD1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. At least six isoforms of LEMD1 are known to exist, this antibody will detect the longest isoform. LEMD1 antibody is predicted to not cross-react with LEMD2 and LEMD3.
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
848,00 €
Artikelnummer: ELK-ES19585.100
Recommended dilutions: WB 1:1000-2000. Cellular localization: Membrane , Single-pass membrane protein .
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: CSB-CL715035HU.10
Length: 546 Sequence: atggtggatg tgaagtgtct gagtgactgt aaattgcaga accaacttga gaagcttgga ttttcacctg gcccaatact accttccacc agaaagttgt atgaaaaaaa gttagtacag ttgttggtct cacctccctg tgcaccacct gtgatgaatg gacccagaga gctggatgga gcgcaggaca gtgatgacag cgaagagctt aatatcattt tgcaaggaaa tatcatactc tcaacaaaaa aaagcaagaa...
| Schlagworte: | CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
213,00 €
Artikelnummer: CSB-PA715035LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA715035LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA715035LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA715035LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: ATA-APrEST95935.100
PrEST Antigen LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Antigen sequence: DVKCLSDCKLQNQLEKLGFSPGPILPSTRKLY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 75% Rat gene identity: 75%
| Schlagworte: | CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €