Zu "GeneID 93273" wurden 10 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-LEMD1
Artikelnummer: G-PACO61394.50
LEMD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. LEMD1 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
313,00 €
Anti-LEMD1
Artikelnummer: ATA-HPA076708.100
Polyclonal Antibody against Human LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Validated applications: ICC, Uniprot ID: Q68G75, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 75% Rat gene identity: 75%
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-LEMD1
Artikelnummer: 600-401-CJ1
Anti-LEMD1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. At least six isoforms of LEMD1 are known to exist, this antibody will detect the longest isoform. LEMD1 antibody is predicted to not cross-react with LEMD2 and LEMD3.
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
848,00 €
Anti-LEMD1
Artikelnummer: ELK-ES19585.100
Recommended dilutions: WB 1:1000-2000. Cellular localization: Membrane , Single-pass membrane protein .
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
LEMD1 (Vector pUC, Accession No. BC036636)
Artikelnummer: CSB-CL715035HU.10
Length: 546 Sequence: atggtggatg tgaagtgtct gagtgactgt aaattgcaga accaacttga gaagcttgga ttttcacctg gcccaatact accttccacc agaaagttgt atgaaaaaaa gttagtacag ttgttggtct cacctccctg tgcaccacct gtgatgaatg gacccagaga gctggatgga gcgcaggaca gtgatgacag cgaagagctt aatatcattt tgcaaggaaa tatcatactc tcaacaaaaa aaagcaagaa...
| Schlagworte: | CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
213,00 €
Anti-LEMD1, HRP conjugated
Artikelnummer: CSB-PA715035LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-LEMD1, Biotin conjugated
Artikelnummer: CSB-PA715035LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-LEMD1
Artikelnummer: CSB-PA715035LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-LEMD1, FITC conjugated
Artikelnummer: CSB-PA715035LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
| Schlagworte: | Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
LEMD1 PrEST Antigen
Artikelnummer: ATA-APrEST95935.100
PrEST Antigen LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Antigen sequence: DVKCLSDCKLQNQLEKLGFSPGPILPSTRKLY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 75% Rat gene identity: 75%
| Schlagworte: | CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €