Zu "GeneID 93273" wurden 11 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-LEMD1
Anti-LEMD1

Artikelnummer: G-PACO61394.50

LEMD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. LEMD1 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Anwendung: ELISA, IHC, IF
Wirt: Rabbit
Spezies-Reaktivität: human
313,00 €
Bewerten
Anti-LEMD1
Anti-LEMD1

Artikelnummer: ATA-HPA076708.100

Polyclonal Antibody against Human LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Validated applications: ICC, Uniprot ID: Q68G75, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 75% Rat gene identity: 75%
Schlagworte: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-LEMD1
Anti-LEMD1

Artikelnummer: ATA-HPA076708.25

Polyclonal Antibody against Human LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Validated applications: ICC, Uniprot ID: Q68G75, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 75% Rat gene identity: 75%
Schlagworte: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
Anti-LEMD1
Anti-LEMD1

Artikelnummer: 600-401-CJ1

Anti-LEMD1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. At least six isoforms of LEMD1 are known to exist, this antibody will detect the longest isoform. LEMD1 antibody is predicted to not cross-react with LEMD2 and LEMD3.
Schlagworte: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
848,00 €
Bewerten
Anti-LEMD1
Anti-LEMD1

Artikelnummer: ELK-ES19585.100

Recommended dilutions: WB 1:1000-2000. Cellular localization: Membrane , Single-pass membrane protein .
Schlagworte: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 173,00 €
Bewerten
LEMD1 (Vector pUC, Accession No. BC036636)
LEMD1 (Vector pUC, Accession No. BC036636)

Artikelnummer: CSB-CL715035HU.10

Length: 546 Sequence: atggtggatg tgaagtgtct gagtgactgt aaattgcaga accaacttga gaagcttgga ttttcacctg gcccaatact accttccacc agaaagttgt atgaaaaaaa gttagtacag ttgttggtct cacctccctg tgcaccacct gtgatgaatg gacccagaga gctggatgga gcgcaggaca gtgatgacag cgaagagctt aatatcattt tgcaaggaaa tatcatactc tcaacaaaaa aaagcaagaa...
Schlagworte: CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
213,00 €
Bewerten
Anti-LEMD1, HRP conjugated
Anti-LEMD1, HRP conjugated

Artikelnummer: CSB-PA715035LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
Schlagworte: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-LEMD1, Biotin conjugated
Anti-LEMD1, Biotin conjugated

Artikelnummer: CSB-PA715035LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
Schlagworte: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-LEMD1
Anti-LEMD1

Artikelnummer: CSB-PA715035LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
Schlagworte: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Anwendung: ELISA, IHC, IF
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-LEMD1, FITC conjugated
Anti-LEMD1, FITC conjugated

Artikelnummer: CSB-PA715035LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LEMD1. Antigen Species: Human
Schlagworte: Anti-CT50, Anti-LEMD1, Anti-LEMP-1, Anti-LEM domain protein 1, Anti-Cancer/testis antigen 50, Anti-LEM domain-containing...
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
LEMD1 PrEST Antigen
LEMD1 PrEST Antigen

Artikelnummer: ATA-APrEST95935.100

PrEST Antigen LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Antigen sequence: DVKCLSDCKLQNQLEKLGFSPGPILPSTRKLY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 75% Rat gene identity: 75%
Schlagworte: CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten