Zu "GeneID 9277" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-WDR46
Artikelnummer: ATA-HPA043004.100
Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to...
| Schlagworte: | Anti-FP221, Anti-BING4, Anti-WDR46, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-WDR46 / BING4
Artikelnummer: NSJ-RQ7402
0.5mg/ml if reconstituted with 0.2ml sterile DI water. WD repeat-containing protein 46 is a protein that in humans is encoded by the WDR46 gene. Enables RNA binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Predicted to be located...
| Schlagworte: | Anti-FP221, Anti-WDR46, Anti-BING4, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4, WDR46... |
| Anwendung: | WB, FC, Direct ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
790,00 €
Anti-WDR46
Artikelnummer: ATA-HPA055425.100
Polyclonal Antibody against Human WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Validated applications: ICC, Uniprot ID: O15213, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Scaffold component of the...
| Schlagworte: | Anti-WDR46, Anti-BING4, Anti-FP221, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-WDR46
Artikelnummer: ATA-HPA055425.25
Polyclonal Antibody against Human WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Validated applications: ICC, Uniprot ID: O15213, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Scaffold component of the...
| Schlagworte: | Anti-WDR46, Anti-BING4, Anti-FP221, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
C6orf11, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-1322
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | WDR46, BING4, FP221, WD repeat-containing protein 46, WD repeat-containing protein BING4 |
| Anwendung: | RNA quantification |
45,00 €
WDR46 PrEST Antigen
Artikelnummer: ATA-APrEST82937.100
Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | FP221, BING4, WDR46, WD repeat-containing protein 46, WD repeat-containing protein BING4 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
WDR46 (Vector pUC, Accession No. BC000388)
Artikelnummer: CSB-CL026034HU.10
Length: 1833 Sequence: atggagacag cccccaagcc gggcaaggat gtcccgccca agaaagacaa acttcagacc aagagaaaga aaccgcggcg atactgggag gaagagaccg ttccgaccac agccggagcc tctccagggc ctcctcgtaa caagaagaat cgggagctcc gtcctcagag accaaaaaat gcttacatct taaagaagtc tcggatctct aagaagcctc aggtcccgaa gaaaccccga gaatggaaga acccggagtc...
| Schlagworte: | FP221, BING4, WDR46, WD repeat-containing protein 46, WD repeat-containing protein BING4 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
671,00 €
Anti-WDR46
Artikelnummer: CSB-PA026034GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: WDR46. Antigen Species: Human
| Schlagworte: | Anti-BING4, Anti-FP221, Anti-WDR46, Anti-WD repeat-containing protein 46, Anti-WD repeat-containing protein BING4, WDR46... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
WDR46 (human), recombinant protein
Artikelnummer: ABS-PP-691.100
Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium]
| Schlagworte: | WD repeat-containing protein 46, WD repeat-containing protein BING4, Recombinant Human WDR46 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 21 kD |
ab 90,00 €
WDR46 PrEST Antigen
Artikelnummer: ATA-APrEST96212.100
PrEST Antigen WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Antigen sequence: LSTRTLPHGAGHLAFSQRGLLVAGMGDVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Scaffold component...
| Schlagworte: | WDR46, BING4, FP221, WD repeat-containing protein 46, WD repeat-containing protein BING4 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
WDR46 (human), recombinant protein
Artikelnummer: ABS-PP-691-L.100
Protein function: Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus. [The UniProt Consortium]
| Schlagworte: | WD repeat-containing protein 46, WD repeat-containing protein BING4, Recombinant Human WDR46 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 21 kD |
ab 115,00 €