Zu "GeneID 92211" wurden 7 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-CDHR1
Artikelnummer: ATA-HPA036819.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse:...
| Schlagworte: | Anti-prCAD, Anti-KIAA1775, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-CDHR1
Artikelnummer: ATA-HPA010795.100
Polyclonal Antibody against Human CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names: CORD15, KIAA1775, PCDH21, RP65, Validated applications: ICC, Uniprot ID: Q96JP9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Potential...
| Schlagworte: | Anti-prCAD, Anti-KIAA1775, Anti-Protocadherin-21, Anti-Photoreceptor cadherin, Anti-Cadherin-related family member 1 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
CDHR1 (human), recombinant protein
Artikelnummer: ABS-PQ-755-L.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium]
| Schlagworte: | Cadherin-related family member 1, Photoreceptor cadherin, prCAD, Protocadherin-21, Recombinant Human CDHR1 Protein |
| Exprimiert in: | human cells |
| Ursprungsart: | human |
| MW: | 13.5 kD |
ab 295,00 €
KIAA1775, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-5042
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | CDHR1, prCAD, KIAA1775, Protocadherin-21, Photoreceptor cadherin, Cadherin-related family member 1 |
| Anwendung: | RNA quantification |
45,00 €
CDHR1 PrEST Antigen
Artikelnummer: ATA-APrEST79641.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | prCAD, KIAA1775, Protocadherin-21, Photoreceptor cadherin, Cadherin-related family member 1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
CDHR1 (human), recombinant protein
Artikelnummer: ABS-PQ-755.100
Protein function: Potential calcium-dependent cell-adhesion protein. May be required for the structural integrity of the outer segment (OS) of photoreceptor cells. [The UniProt Consortium]
| Schlagworte: | Cadherin-related family member 1, Photoreceptor cadherin, prCAD, Protocadherin-21, Recombinant Human CDHR1 Protein |
| Exprimiert in: | human cells |
| Ursprungsart: | human |
| MW: | 13.5 kD |
ab 270,00 €
CDHR1 PrEST Antigen
Artikelnummer: ATA-APrEST95578.100
PrEST Antigen CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names: CORD15, KIAA1775, PCDH21, RP65, Antigen sequence: ATVPVTIRIVDLNNHPPTFYGESGPQNRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKVLTFKLLAVEVNTPEKFSSTADV, Storage: Upon delivery store at -20°C. Avoid...
| Schlagworte: | prCAD, KIAA1775, Protocadherin-21, Photoreceptor cadherin, Cadherin-related family member 1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €