- Suchergebnis für GeneID 913
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 913" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA070634.100
Polyclonal Antibody against Human CD1E, Gene description: CD1e molecule, Validated applications: ICC, Uniprot ID: P15812, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including...
Schlagworte: | Anti-CD1E |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: CSB-PA001432.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Schlagworte: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 126,00 €
Artikelnummer: CSB-PA005193.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Schlagworte: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 126,00 €
Artikelnummer: CSB-PA912791.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Schlagworte: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
283,00 €
Artikelnummer: NSJ-F52013-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. CD1E encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and...
Schlagworte: | Anti-CD1E, CD1e Antibody |
Anwendung: | WB, IHC, FC, IF, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 350,00 €
Artikelnummer: ATA-HPA057769.100
Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl inositides and diacylated sulfoglycolipids, and is required for the presentation of glycolipid antigens on the cell surface. The membrane-associated form is not active. [The UniProt Consortium] Buffer: 40%...
Schlagworte: | Anti-CD1E |
Anwendung: | IHC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €

Artikelnummer: ATA-APrEST96173.100
PrEST Antigen CD1E, Gene description: CD1e molecule, Antigen sequence: ISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl...
Schlagworte: | CD1E |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: CSB-PA004893LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Schlagworte: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA004893LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Schlagworte: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA004893LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Schlagworte: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA004893LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CD1E. Antigen Species: Human
Schlagworte: | Anti-CD1E, CD_antigen=CD1e antibody, CD1A antibody, CD1e antibody, CD1e antigen antibody, CD1E antigen, e polypeptide... |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: VHPS-1669
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | CD1e, CD1E, R2G1, hCD1e, sCD1e, T-cell surface glycoprotein CD1e, soluble, T-cell surface glycoprotein CD1e,... |
Anwendung: | RNA quantification |
44,00 €